Release Notes for the DocBook XSL Stylesheets$Revision: 9401 $ $Date: 2012-06-04 21:47:26 +0000 (Mon, 04 Jun 2012) $This release-notes
document is available in the following formats:
HTML,
PDF,
plain text; it provides a per-release list
of enhancements and changes to the stylesheets’ public APIs
(user-configurable parameters) and excludes descriptions of most
bug fixes. For a complete list of all changes (including all bug
fixes) that have been made since the previous release, see the
separate NEWS (plain text) or NEWS.html files. Also available:
An online hyperlinked change history (warning: big file) of all
changes made over the entire history of the codebase.As with all DocBook Project dot-zero releases, this is an
experimental release. It will be followed shortly by a stable
release.As with all DocBook Project “dot
one plus” releases, this release aspires to be stable (in
contrast to dot-zero releases, which
are experimental).This is a pre-release “snapshot” of the
DocBook XSL Stylesheets. The change information in the first
section of this file
(for “”) is
auto-generated from change descriptions stored in the project
source-code repository.That means the first section contains
descriptions both of bug fixes and of feature changes. The
remaining sections are manually edited changelog subsets that
exclude bug-fix descriptions – that is, trimmed down to just those
those descriptions that document enhancements and changes to the
public APIs (user-configurable parameters).Release Notes: 1.77.1The following list summarizes the major changes that have been made
since the 1.76.1 release. It is followed by sections detailing changes to individual files
from the SVN checkin logs, edited to remove housekeeping changes and bug fixes.
See the NEWS.xml file for a complete unedited list of SVN changes.GentextwebhelpMany improvements to the generated text for webhelp output.CommonSupport more media typesExpanded list of supported filename extensions for media to include video and audio, mostly for HTML5 and EPUB3 outputs.Topic elementAdd basic support for new topic element, which is available in DocBook 5.1. Generally a topic element will be used with assembly and may be transformed to some other hierarchical element during processing, but it can also be formatted as a plain topic.FOAdd para.properties attribute-setAdd a para.properties attribute-set that applies only to para elements. That allows still using normal.para.spacing attribute-set for many block elements for uniform spacing, but allows separate formatting of para elements.List of titles in articleAdd support for List of Tables, List of Figures, etc. for articles and other component-level elements. Includes a new template for each in autotoc.xsl, new attribute-sets in titlepage.xsl, and new entries in the titlepage.templates.xml file tu support customization.Customizing links in FOAdd template mode simple.xlink.properties to allow
easy customization of formatting of links generated
from elements that use
the xlink attributes. This extends link formatting beyond that of xref, link, and olink which use xref.properties attribute-set.Table captionThe caption element in an HTML table is now handled like a title in a CALS table, using the formal.object.title template with all its features, including placement. Now caption template in mode="htmlTable" does nothing, because
caption handled by formal.object.title template. Also adds support for table caption element in a CALS table, placing it after the table.Graphics attribute handlingRefactored the big process.image template to use individual templates such as image.width for most attributes to allow easier customization of individual properties.Side regionsAdd support for side page regions in addition to header and footer regions. This feature lets you add running content to the side margins, and by default the content is rotated 90 degrees. Adds new templates named running.side.content, region.inner and region.outer; new template modes region.inner.mode and region.outer.mode; new parameters named region.inner.extent, region.outer.extent, body.margin.inner, body.margin.outer, and side.region.precedence; and new attribute-sets named inner.region.content.properties, outer.region.content.properties, region.inner.properties, and region.outer.properties.Callout formattingAdd new attribute-sets for calloutlist.Topic elementAdd basic support for formatting a topic element, which is available in DocBook 5.1.HTMLHTML5Add variables to the base HTML stylesheets that can be adjusted for the HTML5 stylesheets.Insert Javascript referenceAdd support for html.script param to insert reference to a Javascript file.Namespace for titlepage mechanism.Titlepage mechanism is now namespace aware to support XHTML.Chunked filename prefixNew param named chunked.filename.prefix lets you add a filename prefix to each chunked file. This replaces the buggy practice of adding such a prefix to the base.dir param. Now the base.dir param will always have a trailing slash added if it is not present, so you no longer have to remember to add it to the param value.Generate id attributesThe stylesheet param generate.id.attributes already existed but was incompletely implemented. Now when it is set to 1, only id attributes should be output, not <a name> named anchors.Generate consistent id attributesNew generate.consistent.ids parameter which allows generating a more stable id values based on XPath rather than the generate-id() function, which may not produce consistent values between runs. Stable output ids allow you to make stable links to generated content from the outside.Topic elementAdd basic support for formatting a topic element, which is available in DocBook 5.1. Generally a topic element will be used with assembly and may be transformed to some other hierarchical element during processing, but it can also be formatted as a plain topic.WebhelpWebhelp refactoredWebhelp templates refactored to better support customization.Added documentation.More and better documentation added.Webhelp generated textMany improvements to the generated text for webhelp output.XHTML5New stylesheets to generate HTML5 output, in an XML serialization. These templates are a customization layer on top of the XHTML stylesheet files.EPUB3New stylesheets to generate EPUB3 output. These templates are a customization layer on top of the xhtml5 stylesheet files.AssemblyNew assembly.xsl stylesheet to convert a DocBook 5.1 assembly into a standard DocBook 5 document. Also includes a topic-maker-chunk.xsl stylesheet that can convert a DocBook 5 book or article document into an assembly with a collection of modular files, including converting some elements to topic files.GentextThe following changes have been made to the
gentext code
since the 1.76.1 release.stefanhinz: locale/de.xmlTranslated German WebHelp stringsDavid Cramer: locale/zh.xml; locale/en.xml; locale/fr.xml; locale/de.xml; locale/ja.xmlWebhelp: Update non-en gentext stringsRobert Stayton: locale/en.xmlAdd topic to title-numbered context.Robert Stayton: locale/en.xmlAdd basic topic element templates.Mauritz Jeanson: locale/el.xmlUpdated gentext for quotation marks. Fixes bug #3512440.Jirka Kosek: locale/cs.xmlAdding missing context for webhelpDavid Cramer: locale/en.xmlFixing syntax of webhelp gentext entriesDavid Cramer: locale/en.xmlMoving webhelp gentext strings into a contexttom_schr: locale/zh.xml; locale/en.xml; locale/cs.xml; locale/fr.xml; locale/de.xml; local⋯Moved language specific of WebHelp to gentext/locale/ as discussed with
Stefan following the "minimal intrusive approach". :)
In the long run, maybe moving the text into a context, not sure.Jirka Kosek: locale/ru.xmlAligned capitalization of first letters with English originalCommonThe following changes have been made to the
common code
since the 1.76.1 release.Robert Stayton: common.xslIn "select.mediaobject.index" template, add selection of videoobject
and audioobject since now supported in HTML5.Robert Stayton: labels.xsl; titles.xsl; entities.ent; targets.xsl; subtitles.xsl; gentext.⋯Add basic support for new <topic> element.Robert Stayton: common.xslFix handling of mediatypes for video and audio files, mostly for HTML5 and EPUB3 outputs.Robert Stayton: olink.xslGenerate error message if olink data in targetset is in a namespace.Robert Stayton: common.xslAdd support for generate.consistent.ids parameter.Robert Stayton: subtitles.xslAdd verbose param to subtitle.markup templates to allow its
error message to be ignored.
Add that param to fop1.xsl application of subtitle.markup
to avoid unnecessary error message in document information.Robert Stayton: labels.xslAdd empty templates for glossdiv, glosslist, and glossentry in
mode="label.markup".FOThe following changes have been made to the
fo code
since the 1.76.1 release.Robert Stayton: graphics.xslqualify caption template to mediaobject/caption so not confused with table/caption.Robert Stayton: table.xslAdd template to process table/caption element.Robert Stayton: titlepage.xsl; autotoc.xsl; component.xsl; xref.xsl; titlepage.templates.x⋯Add basic support for new <topic> element.Robert Stayton: graphics.xslFix handling of mediatypes for video and audio files, mostly for HTML5 and EPUB3 outputs.Robert Stayton: titlepage.xslAdd default style att-sets for component.list.of.titles, etc.Robert Stayton: autotoc.xsl; component.xsl; titlepage.templates.xmlAdd make.component.tocs to support lists of tables, etc. for
article and other components. Added component.list.of.tables to
titlepage.templates.xml to format the title.Robert Stayton: param.xweb; param.entAdd new para.properties attribute-set for paragraphs.Robert Stayton: inline.xslAdd template mode 'simple.xlink.properties' to allow
easy customization of formatting of links generated
from elements other than xref, link, and olink using
the xlink attributes.Robert Stayton: param.xweb; param.entAdd table.caption.properties to format table captions.Robert Stayton: table.xslAdd support for caption in a CALS table.Robert Stayton: graphics.xsl; math.xslRefactored the 'process.image' template to create modular
templates for each attribute so they can be individually
customized. Also merged in support for embedded svg and
mml content so they can have image attributes too.Robert Stayton: param.xweb; param.entCheck in new params for FO side regions in page masters.Robert Stayton: titlepage.xsl; titlepage.templates.xmlAdd support for itermset in info elements, using titlepage mechanism
to ensure entries are placed inside page-sequence.Robert Stayton: pagesetup.xslAdd support for side body margins and side static content regions.
Fixes bug 3389931.Robert Stayton: param.xweb; param.ent; task.xslAdd attribute-set task.properties to task element to
support customization.Robert Stayton: lists.xsl; param.xweb; param.entAdd new attribute-sets calloutlist.properties and callout.properties
to better support customization of calloutlists, fixing bug 3160341.Jirka Kosek: MakefileTitlepage mechanism is now namespace aware to support XHTML. Please note that when generating titlepage template stylesheets you have to pass FO or XHTML namespace inside ns parameter. For HTML parameter should be empty.Robert Stayton: graphics.xslAllow selection by role for multiple imageobject elements
within an imageobjectco, which since Docbook 5 allows multiple imageobjects.Mauritz Jeanson: titlepage.xslAdded template for collabname. Fixes bug #3414436.David Cramer: verbatim.xslSupport the keep-together processing-instruction on programlisting, screen, synopsis, and literallayout. Tracker id #3396906.Robert Stayton: pagesetup.xslPass the pageclass, sequence, and gentext-key to the template
named header.footer.widths to enable further customization
based on page master.Jirka Kosek: xref.xslhyphenation of URL content must be disabled for link, not only for ulink because od DB5Jirka Kosek: xref.xslURLs shouldn't be hyphenated as normal textJirka Kosek: callout.xslAdded support for alternative circled numbersMauritz Jeanson: axf.xsl; fop1.xsl; xep.xslAdded support for author/orgname in document metadata. Closes bug #3132862.Robert Stayton: component.xslAdd template for article/colophon to avoid nested page-sequence.HTMLThe following changes have been made to the
html code
since the 1.76.1 release.Robert Stayton: xref.xslAdd support for using info/title as well as title in target element.Robert Stayton: component.xslEnable support for html5 features, including using <section> instead of
<div> for certain elements, and setting heading level to <h1> for chapters.
These features are not changed in the base html stylesheet for backwards
compatibility.Robert Stayton: docbook.css.xmlAdd style for footnote rule.Robert Stayton: biblio-iso690.xslAdd support for subtitle inside info.Robert Stayton: docbook.xslAdd call to new 'root.attributes' placeholder template to allow
adding attributes to the <html> output element.Robert Stayton: inline.xsl; titlepage.xsl; formal.xsl; division.xsl; toc.xsl; sections.xsl⋯Finish implementation of generate.id.attributes for all elements
using the template named id.attribute.Robert Stayton: autotoc.xsl; chunktoc.xsl; titlepage.xsl; chunk-code.xsl; changebars.xsl; ⋯Add basic support for new <topic> element.Robert Stayton: graphics.xslFix handling of mediatypes for video and audio files, mostly for HTML5 and EPUB3 outputs.Robert Stayton: callout.xsl; verbatim.xslRestore programlisting to use <pre> instead of <div> and instead
wrap callout img elements in <span> to make valid HTML.Robert Stayton: graphics.xslTurn off img longdesc attribute because not supported by browsers.Robert Stayton: footnote.xslMove square brackets and <sup> inside <a> element for footnote
marks to fix display problems in some browsers.Robert Stayton: param.xweb; param.entAdd new params html.script and html.script.type to support
Javascript references.Robert Stayton: chunk-common.xsl; chunktoc.xsl; titlepage.xsl; chunker.xsl; chunk-code.xsl⋯Add support for chunked.filename.prefix param.
Make sure base.dir value has a trailing slash in
the chunk.base.dir internal param used by the templates.Robert Stayton: formal.xsl; htmltbl.xslNow handles caption in html markup table like title,
so formal.object.title is used with all its features, including
formatting and placement.
Added htmlTable.with.caption template to handle the wrapper, and
left htmlTable template unchanged.
Now caption template in mode="htmlTable" does nothing, because
caption handled by formal.object.title template.Robert Stayton: html.xslTurn off generating the title attribute for block and hierarchical elements.
Should only be used for inline elements, usually using the alt element.
Also used for links to show the target title.Robert Stayton: lists.xslThe spacing="compact" attribute on lists in HTML no longer outputs compact="compact"
(or just "compact" in the case of Saxon 6), since that attribute is
deprecated and improperly supported. Instead, the output uses a
multiple class attribute such as class="orderedlist compact".
Use CSS to style such lists without margin above.Robert Stayton: graphics.xslAllow selection by role for multiple imageobject elements
within an imageobjectco, which since Docbook 5 allows multiple imageobjects.Robert Stayton: pi.xslImprove doc descriptions of dbhtml filename and dir.Robert Stayton: autoidx.xslAdd setindex to context param in mode="reference" to better
support setindex.Robert Stayton: autotoc.xslSupport set as child of set in set.toc template.Robert Stayton: qandaset.xslChange question and title templates to replace hard-coded
class="local-name()" with mode="class.attribute" to support customization
of class values.Norman Walsh: chunktoc.xslSeparate book appendixes from article appendixes (so that they can be customized independently)Mauritz Jeanson: graphics.xslAdded condition to prevent "Failed to interpret image" messages (SVG is not supported
by the graphic size extension).EpubThe following changes have been made to the
epub code
since the 1.76.1 release.Robert Stayton: docbook.xslReplace $base.dir with $chunk.base.dir to ensure trailing slash in place.HTMLHelpThe following changes have been made to the
htmlhelp code
since the 1.76.1 release.Robert Stayton: htmlhelp-common.xslChange $base.dir to $chunk.base.dir to ensure trailing slash in place.EclipseThe following changes have been made to the
eclipse code
since the 1.76.1 release.Robert Stayton: eclipse.xsl; eclipse3.xslUse $chunk.base.dir instead of $base.dir to ensure trailing slash is in place.JavaHelpThe following changes have been made to the
javahelp code
since the 1.76.1 release.Robert Stayton: javahelp.xslChange $base.dir to $chunk.base.dir to ensure trailing slash is present.Mauritz Jeanson: javahelp.xslReplaced empty header.navigation and footer.navigation templates with parameter suppress.navigation=1,
which simplifies customization. See bug #3310904.WebhelpThe following changes have been made to the
webhelp code
since the 1.76.1 release.David Cramer: template/common/css/positioning.cssWebhelp: Adding print-only css rulesDavid Cramer: template/common/main.jsWebhelp: Arun's fix for bug where heading was partially hidden by header in some situations.David Cramer: xsl/webhelp-common.xslWebhelp: turn off autolabeling by defaultDavid Cramer: xsl/webhelp.xslWebhelp: Import xhtml base stylesheetsDavid Cramer: docsrc/readme.xmlWebhelp: Link to the DocBook reference docs from the webhelp readmeDavid Cramer: xsl/webhelp-common.xslWebhelp: Use gentext value for noscript warningDavid Cramer: MakefileWebhelp: Delete tempfile after DocBook xsl buildDavid Cramer: xsl/webhelp.xslWebhelp: moving parameters into the standard location so they will be part of the parameter referenceDavid Cramer: xsl/webhelp.xsl; xsl/webhelp-common.xslWebhelp: moving parameters into the standard location so they will be part of the parameter referenceDavid Cramer: template/common/main.jsWebhelp: tweaking scrolldown offset for anchorsDavid Cramer: docsrc/images; docsrc/images/sample.jpg; docsrc/readme.xml; template/content⋯Webhelp: updating docs. Ant version, install instructions, handling of images.David Cramer: xsl/webhelp.xslPatch from Arun Bharadwaj to display message if JavaScript is disabledDavid Cramer: template/content/search/nwSearchFnt.jsPatch from Arun Bharadwaj to strip quotes from search query stringsRobert Stayton: xsl/webhelp.xslAdd basic support for new <topic> element.Jirka Kosek: xsl/webhelp.xslPut back old extensibility point.
Guys, please don't remove existing extensibility points like named templates, it will break existing customizations.David Cramer: xsl/webhelp.xslMoving webhelp gentext strings into a contexttom_schr: param.entDisabled branding and brandname entities for the time beingtom_schr: param.xweb; param.entPrepared WebHelp reference documentation :)
Not clear about parameters brandname and branding: Should they renamed
to "webhelp.branding" and "webhelp.brandname"?
Currently, docsrc/reference.xml contains only a comment for the WebHelp
ref doc to be non-intrusive.
Idea is to enable it when it is readytom_schr: xsl/webhelp.xslMoved language specific of WebHelp to gentext/locale/ as discussed with
Stefan following the "minimal intrusive approach". :)
In the long run, maybe moving the text into a context, not sure.David Cramer: template/common/css/positioning.cssWebhelp: Lower the minimum width of content panekasunbg: xsl/webhelp.xsl; template/common/main.jsIf an user moved to another page by clicking on a toclink, and then clicked on #searchDiv,
search should be performed if the cookie textToSearch is not empty.David Cramer: xsl/webhelp.xslWebhelp: Left align titles in nav header. Display for all but the topmost pageDavid Cramer: template/content/search/stemmers/en_stemmer.js; docsrc/xinclude-test.xmlWebhelp: Cleanup related to en_stemmer.js changesDavid Cramer: template/common/css/positioning.cssWebhelp: Don't put borders around qandaset listDavid Cramer: template/common/main.jsWebhelp: Avoid unnecessary scroll ups when anchor is clicked onDavid Cramer: build.propertiesWebhelp: Show footer nav by defaultDavid Cramer: build.properties; build.xmlWebhelp: Support setting suppress.footer.navigation from build.propertiesDavid Cramer: build.properties; build.xmlWebhelp: Support admon.graphics param in build.propertiesDavid Cramer: docsrc/xinclude-test.xml; docsrc/readme.xmlWebhelp: Adding xinclude example to the demo/readme docDavid Cramer: template/common/css/positioning.cssWebhelp: Remove border around table used to format callout listDavid Cramer: xsl/webhelp.xsl; template/common/images/admon/tip.png; template/common/image⋯Webhelp: Support admon graphics (still off by default)David Cramer: xsl/webhelp.xsl; template/common/css/positioning.cssWebhelp: Turn on navfooter and fix related cssDavid Cramer: xsl/webhelp.xslWebhelp: Fix error about undeclared doc.title paramDavid Cramer: docsrc/readme.xmlWebhelp: Adding some test search terms to the readmeDavid Cramer: template/content/search/stemmers/en_stemmer.jsHandle exceptional cases listed in the Porter 2 stemming algoDavid Cramer: template/content/search/stemmers/en_stemmer.jsWebhelp: adding special case word 'say' to en js stemmerDavid Cramer: template/content/search/stemmers/en_stemmer.jsWebhelp: Refine stemming of terms that end in (only stem if there's a consonant before the -y)David Cramer: template/content/search/stemmers/en_stemmer.js; template/content/search/nwSe⋯Webhelp: fixed bug where words like key, day, and nucleus, were not found due to differences in the way the client stemmer and indexer stemmed wordsDavid Cramer: build.xmlWebhelp: Support xinclude and two-pass profiling in build.xmlDavid Cramer: xsl/webhelp.xslFix bad link to default topic.kasunbg: docsrc/readme.xmlAutomatically limit the size of the search description to something 140 characterskasunbg: xsl/webhelp.xslremoving outline in 'contents' and 'search' buttons that is visible when clicked. tabindex for SIDEBAR button.kasunbg: xsl/webhelp.xsl; build.xmlWebhelp ant script changes - HTML transformation support for WebHelp - Uses Tagsoup for parsing the bad html.
tagsoup-1.2.1.jar is added to trunk/xsl-webhelpindexer/lib/kasunbg: xsl/webhelp.xslproper support for saxon xhtml transformation.kasunbg: template/common/images/callouts/10.png; template/common/images/callouts/11.png; t⋯webhelp - adding calloutskasunbg: xsl/webhelp.xsl; template/common/main.js; template/common/css/positioning.csswebhelp - animations for show/hide Sidebarkasunbg: build.propertiescommenting about brand and brandnamekasunbg: Makefileparameterized MAKE for webhelpkasunbg: xsl/webhelp.xsl; template/common/css/positioning.css; build.properties; build.xmlwebhelp xsl customization - logokasunbg: template/content/search/nwSearchFnt.jsremove some JS warniningskasunbg: template/content/search/nwSearchFnt.jsFix for missing "No results found for..." bugkasunbg: xsl/webhelp.xslcommented about the importance of the order of css contents. Order is important between the in-html-file css and the linked css files. Some css declarations in jquery-ui-1.8.2.custom.css are over-ridden. If that's a concern, just remove the additional css contents inside these default jquery css files. I thought of keeping them intact for easier maintenance.Jirka Kosek: xsl/webhelp.xsl; template/common/css/positioning.cssMinor cleanup, added extensibility hook, some styling moved into CSS for easier customizationDavid Cramer: template/content/search/nwSearchFnt.jsRemoving onclick that came from Oxygen's dita stuffkasunbg: docsrc/readme.xmlwebhelp - documenting about featureskasunbg: template/common/css/positioning.csswebhelp search text boxkasunbg: template/common/css/positioning.cssadding header background imagekasunbg: xsl/webhelp.xsl; template/common/images/header-bg.pngnew header background imagekasunbg: xsl/webhelp.xsl; template/common/css/positioning.cssfix left navigationkasunbg: template/common/css/positioning.csssome csskasunbg: build.xmlAdding html.extension propertykasunbg: template/common/css/positioning.css; build.properties; build.xmlwebhelp - Adding enable.stemming, toc.file build propertiesDavid Cramer: template/common/css/positioning.cssMake the webhelp banner slightly larger.David Cramer: template/common/main.js; template/common/css/positioning.cssAdjust colors and positioning of header and search/toc tabsDavid Cramer: xsl/webhelp.xslOnly put doc title in headerDavid Cramer: template/common/css/positioning.css; template/common/images/main_bg_fade.pngAdjusting default color of the headerkasunbg: xsl/webhelp.xsl; template/common/css/positioning.cssadjustments to header title. Now output in Opera looks good.kasunbg: template/common/images/sidebar.png; template/content/search/punctuation.props; te⋯deleting svn:executable flag from webhelp fileskasunbg: xsl/webhelp.xsl; template/common/css/positioning.css; template/common/images/sear⋯Customized the left navagation headers; Contents and Search.
Adding custom css for the current redmond ui of jquery-ui. These override jquery-ui's default css customizations. These are supposed to take precedence.kasunbg: docsrc/readme.xmltypo fixkasunbg: template/common/images/next-arrow.png; xsl/webhelp.xsl; template/common/main.js; ⋯UI improvements.
Moved search highligher to search tab.
Added nice icons for navigation buttons etc.
Removed footer navigation
Corrected tree colorings
Overall, some css magicDavid Cramer: docsrc/readme.xmlAdded listitem thinking SyncRO Soft for their contributions.kasunbg: build.xmlsupport for default classpath for Gentoo Linuxkasunbg: docsrc/readme.xmlwebhelp - some updates to the documentation about searchkasunbg: template/common/css/positioning.cssFix for issue 'Keep "search" & "contents" titles always visible in webhelp - ID: 3403438'David Cramer: template/common/images/starsSmall.pngChanged icons used to show search weightings from stars to boxes so they won't look like user ratingsDavid Cramer: xsl/webhelp.xsl; template/common/main.js; template/common/images/starsSmall.⋯Merged Oxygen webhelp improvements (search weightings etc) into trunk: -r9031:9039kasunbg: docsrc/readme.xmlwebhelp documentation - search indexing, faqkasunbg: docsrc/readme.xmlupdate webhelp documentationDavid Cramer: xsl/webhelp.xslFixed bug where webhelp.default.topic was not being used if it was setDavid Cramer: xsl/webhelp.xsl; template/content/search/nwSearchFnt.jsLocalize string in nwSearchFnt.js fileDavid Cramer: xsl/webhelp.xslAdded tabindex attributes to make tab order in UI more logical in webhelp.David Cramer: template/common/main.jsFixed bug where anchors in pages landed beneath the banner.kasunbg: xsl/webhelp.xslAdded more comments to the xsl/webhelp/xsl/webhelp.xsl file. Removed some clutter.David Cramer: template/common/main.jsFixed problem reported in IE 8. See tracker id # 373747.David Cramer: xsl/webhelp.xslAddressed tracker #3247166 by removing hard-coded reference to ch01.html.kasunbg: build.xmlChanged the webhelp build.xml to reflect the changes to xsl-webhelpindexer.
Added classpaths for xercesImpl and xml-api jars to the indexer. Paths added for *nix environments, need to look at how the current system behaves in Windows. Discussion: http://lists.oasis-open.org/archives/docbook-apps/201011/msg00116.htmlkasunbg: template/common/images/loading.gif; template/common/jquery/treeview/jquery.treevi⋯webhelp: Removing some unnecessary JQuery JS fileskasunbg: template/common/main.jswebhelp: Usability improvement - when click on a node in the TOC tree, the child nodes will auto populate now.kasunbg: xsl/webhelp.xslAdded google translated localizations for Japanese, German, French, and Chinese. The translations might not be pretty accurate.
Better translations are appreciated.kasunbg: docsrc/readme.xml; template/content/images; template/content/images/sample.jpgAdded documentation for how to add images to WebHelpJirka Kosek: xsl/webhelp.xslAdded more customization hooks
Search code output only when search tab is active
Added cs localizationJirka Kosek: xsl/webhelp.xslAdded parameter webhelp.common.dir for specifying location of common files (JS+CSS)
Added hooks for adding additional user defined tabsParamsThe following changes have been made to the
params code
since the 1.76.1 release.David Cramer: webhelp.indexer.language.xmlWebhelp: Fixing list of supported languagesDavid Cramer: webhelp.indexer.language.xmlWebhelp: Correct language code in docs for ChineseMauritz Jeanson: admon.graphics.extension.xmlAdded list of graphics formats.Mauritz Jeanson: passivetex.extensions.xmlUpdated link.tom_schr: webhelp.indexer.language.xml; webhelp.default.topic.xml; webhelp.tree.cookie.id.⋯Prepared WebHelp reference documentation :)
Not clear about parameters brandname and branding: Should they renamed
to "webhelp.branding" and "webhelp.brandname"?
Currently, docsrc/reference.xml contains only a comment for the WebHelp
ref doc to be non-intrusive.
Idea is to enable it when it is readyRobert Stayton: glossary.collection.xmlAdd info about relative paths.Robert Stayton: para.properties.xmlSpecial attribute-set for para only.Robert Stayton: table.caption.properties.xmlTo format table captions.Robert Stayton: html.script.type.xml; html.script.xmlAdd support for specifying javascript references like css references.Robert Stayton: body.margin.outer.xml; region.outer.extent.xml; body.margin.inner.xml; reg⋯Add support for side regions in FO output.Robert Stayton: chunked.filename.prefix.xmlNew param chunked.filename.prefix to separate any such prefix from
the base.dir param, which helps fix bug 3087359.Robert Stayton: generate.consistent.ids.xmlNew param to support replacing generate-id() with xsl:number
for more consistent id values.Robert Stayton: task.properties.xmlAllow task to be customized more easily.Robert Stayton: calloutlist.properties.xml; callout.properties.xmlSupport better customization of callout lists.Jirka Kosek: callout.unicode.start.character.xmlAdded support for alternative circled numbersDavid Cramer: example.properties.xmlMade example.properties use keep-together='auto' like table.properies to avoid problems where example/programlisting takes more than one pageMauritz Jeanson: graphicsize.extension.xmlAdded info about supported image formats.HighlightingThe following changes have been made to the
highlighting code
since the 1.76.1 release.Jirka Kosek: csharp-hl.xmlAdded LINQ keywordsJirka Kosek: delphi-hl.xmlAdditional keywords from Yuri ZhilinProfilingThe following changes have been made to the
profiling code
since the 1.76.1 release.David Cramer: profile-mode.xslWhen profile.* params only consist of space characters, then ignore them.LibThe following changes have been made to the
lib code
since the 1.76.1 release.Robert Stayton: lib.xwebAdded two utility templates to make lib.xsl work
without reference to other modules since it is used
that way with profiling/xsl2profile.xsl.Robert Stayton: lib.xwebFix trim.common.uri.paths to first resolve any ../ in
the paths.TemplateThe following changes have been made to the
template code
since the 1.76.1 release.Jirka Kosek: titlepage.xslTitlepage mechanism is now namespace aware to support XHTML. Please note that when generating titlepage template stylesheets you have to pass FO or XHTML namespace inside ns parameter. For HTML parameter should be empty.ExtensionsThe following changes have been made to the
extensions code
since the 1.76.1 release.kasunbg: Makefilewebhelp - Adding enable.stemming, toc.file build propertiesDavid Cramer: MakefileAttempt to convince Makefile that webhelpindexer is dirtyXSL-SaxonThe following changes have been made to the
xsl-saxon code
since the 1.76.1 release.Mauritz Jeanson: src/com/nwalsh/saxon/Verbatim.java; src/com/nwalsh/saxon/FormatGraphicCal⋯Added fixes to ensure that generated XHTML markup for callouts is in the proper namespace.Release Notes: 1.77.1The following is a list of changes that have been made
since the 1.77.0 release.FOThe following changes have been made to the
fo code
since the 1.77.0 release.Robert Stayton: docbook.xslImport the VERSION.xsl file instead of VERSION so mimetype is interpreted correctly
from the filename.Robert Stayton: block.xslIn sidebar, turn off space before first para if there is no title.Robert Stayton: math.xslRestored templates for mml:* elements that were accidentally deleted.HTMLThe following changes have been made to the
html code
since the 1.77.0 release.Robert Stayton: docbook.xslImport the VERSION.xsl file instead of VERSION so mimetype is interpreted correctly
from the filename.Robert Stayton: sections.xslUse $div.element variable in place of div to support html5 section element.
outputRobert Stayton: autoidx.xslFix bug 3528673, missing "separator" param on template with
match="indexterm" mode="reference". That param is passed
for endofrange processing to output the range separator.RoundtripThe following changes have been made to the
roundtrip code
since the 1.77.0 release.Robert Stayton: dbk2ooo.xsl; dbk2pages.xsl; dbk2wordml.xsl; dbk2wp.xslImport the VERSION.xsl file instead of VERSION so mimetype is interpreted correctly
from the filename.SlidesThe following changes have been made to the
slides code
since the 1.77.0 release.Robert Stayton: html/slides-common.xslImport the VERSION.xsl file instead of VERSION so mimetype is interpreted correctly
from the filename.WebsiteThe following changes have been made to the
website code
since the 1.77.0 release.Robert Stayton: website-common.xslImport the VERSION.xsl file instead of VERSION so mimetype is interpreted correctly
from the filename.WebhelpThe following changes have been made to the
webhelp code
since the 1.77.0 release.kasunbg: docsrc/readme.xmlupdated webhelp documentationkasunbg: template/content/search/nwSearchFnt.js; xsl/webhelp-common.xslRemoved the script htmlFileList.js since it's content is in htmlFileInfoList.jsRobert Stayton: xsl/webhelp-common.xslIn the <h1> output, replace call to 'get.doc.title' with
mode="title.markup" because get.doc.title returns only
the string value of the title, losing any markup such
as <trademark> or <superscript>.kasunbg: template/common/css/positioning.css; template/content/search/nwSearchFnt.jsRemove unnecessary bits of code from webhelpDavid Cramer: docsrc/readme.xmlWebhelp: Minor edits to the readmeDavid Cramer: xsl/webhelp.xsl; xsl/titlepage.templates.xsl; xsl/titlepage.templates.xmlWebhelp: Suppress abstracts from titlepages. These are used to create the search result summary sentence and should not be shownDavid Cramer: build.xmlWebhelp: calculate path to profile.xsl from main build.xml fileRelease Notes: 1.76.1The following is a list of changes that have been made
since the 1.76.0 release.FOThe following changes have been made to the
fo code
since the 1.76.0 release.Robert Stayton: docbook.xsl; xref.xsl; fop1.xslApply patch to support named destination in fop1.xsl, per Sourceforge
bug report #3029845.HTMLThe following changes have been made to the html code since the 1.76.0 release.Keith Fahlgren: highlight.xslImplementing handling for <b> and <i>: transform to <strong> and <em> for XHTML outputs and do not use in the highliting output (per Mauritz Jeanson)ParamsThe following changes have been made to the
params code
since the 1.76.0 release.Robert Stayton: draft.mode.xmlChange default for draft.mode to 'no'.Release Notes: 1.76.0This release includes important bug fixes and adds the following
significant feature changes:WebhelpA new browser-based, cross-platform help format with full-text search and other features typically found in help systems. See webhelp/docs/content/ch01.html for more information and a demo. GentextMany updates and additions to translation/locales thanks to Red Hat, the Fedora Project, and other contributors.CommonFaster localization support, as language files are loaded on demand.FOSupport for SVG content in imagedata added.HTMLOutput improved when using 'make.clean.html' and a stock CSS file is now provided.EPUBA number of improvements to NCX, cover and image selection, and XHTML 1.1 element choicesThe following is a list of changes that have been made since the 1.75.2 release.GentextThe following changes have been made to the gentext code since the 1.75.2 release.rlandmann: locale/fa.xmlUpdate to Persian translation from the Fedora Projectrlandmann: locale/nds.xmlLocale for Low GermanMauritz Jeanson: locale/ka.xml; MakefileAdded support for Georgian based on patch #2917147.rlandmann: locale/nl.xml; locale/ja.xmlUpdated translations from Red Hat and the Fedora Projectrlandmann: locale/bs.xml; locale/ru.xml; locale/hr.xmlUpdated locales from Red Hat and the Fedora Projectrlandmann: locale/pt.xml; locale/cs.xml; locale/es.xml; locale/bg.xml; locale/nl.xml; loca⋯Updated translations from Red Hat and the Fedora Projectrlandmann: locale/as.xml; locale/bn_IN.xml; locale/ast.xml; locale/ml.xml; locale/te.xml; ⋯New translations from Red Hat and the Fedora Projectrlandmann: locale/pt.xml; locale/ca.xml; locale/da.xml; locale/sr.xml; locale/ru.xml; loca⋯Updated translations from Red Hat and the Fedora ProjectCommonThe following changes have been made to the common code since the 1.75.2 release.Mauritz Jeanson: common.xslFixed bug in output-orderedlist-starting-number template (@startingnumber did not work for FO).Mauritz Jeanson: gentext.xslAdded fix to catch ID also of descendants of listitem. Closes bug #2955077.Jirka Kosek: l10n.xslStripped down, faster version of gentext.template is used when there is no localization customization.Mauritz Jeanson: stripns.xslAdded fix that preserves link/@role (makes links in the reference documentation
with @role="tcg" work).Mauritz Jeanson: l10n.xslFixed bugs related to manpages and L10n.Jirka Kosek: entities.ent; autoidx-kosek.xslUpgraded to use common entities. Fixed bug when some code used @sortas and some not for grouping/sorting of indexterms.Jirka Kosek: l10n.xsl; l10n.dtd; l10n.xml; autoidx-kosek.xslRefactored localization support. Language files are loaded on demand. Speedup is about 30%.Jirka Kosek: l10n.xslAdded xsl:keys for improved performance of localization texts look up. Performance gain around 15%.Mauritz Jeanson: titles.xslFixed bug #2912677 (error with xref in title).Robert Stayton: olink.xslFix bug in xrefstyle "title" handling introduced with
the 'insert.targetdb.data' template.Robert Stayton: gentext.xslFix bug in xref to equation without title to use context="xref-number" instead
of "xref-number-and-title".Robert Stayton: labels.xslNumber all equations in one sequence, with or without title.Robert Stayton: entities.entFix bug #2896909 where duplicate @sortas on indexterms caused
some indexterms to drop out of index.Robert Stayton: stripns.xslExpand the "Stripping namespace ..." message to advise users to
use the namespaced stylesheets.Robert Stayton: stripns.xslneed a local version of $exsl.node.set.available variable because
this module imported many places.Mauritz Jeanson: olink.xslAdded /node() to the select expression that is used to compute the title text
so that no <ttl> elements end up in the output. Closes bug #2830119.FOThe following changes have been made to the
fo code
since the 1.75.2 release.Robert Stayton: table.xslFix bug 2979166 able - Attribute @rowheader not workingMauritz Jeanson: inline.xslImproved glossterm auto-linking by using keys. The old code was inefficient when processing documents
with many inline glossterms.Robert Stayton: titlepage.xslFix bug 2805530 author/orgname not appearing on title page.Mauritz Jeanson: graphics.xslAdded support for SVG content in imagedata (inspired by patch #2909154).Mauritz Jeanson: table.xslRemoved superfluous test used when computing column-width. Closes bug #3000898.Mauritz Jeanson: inline.xslAdded missing <xsl:call-template name="anchor"/>. Closes bug #2998567.Mauritz Jeanson: lists.xslAdded table-layout="fixed" on segmentedlisttable (required by XSL spec when proportional-column-width() is used).Jirka Kosek: autoidx-kosek.xslUpgraded to use common entities. Fixed bug when some code used @sortas and some not for grouping/sorting of indexterms.Jirka Kosek: index.xslUpgraded to use common entities. Fixed bug when some code used @sortas and some not for grouping/sorting of indexterms.Robert Stayton: xref.xslFix bug in olink template when an olink has an id.
Add warning message with id value when trying to link
to an element that has no generated text.Mauritz Jeanson: refentry.xslFixed bug #2930968 (indexterm in refmeta not handled correctly).Robert Stayton: block.xslfix bug 2949567 title in revhistory breaks FO transform.Robert Stayton: glossary.xslOutput id attributes on glossdiv blocks so they can be added to
xrefs or TOC.Jirka Kosek: xref.xslEnabled hyphenation of URLs when ulink content is the same as link targetRobert Stayton: table.xslApply patch to turn off row recursion if no @morerows attributes present.
This will enable very large tables without row spanning to
process without running into recursion limits.Robert Stayton: formal.xslFormat equation without title using table layout with equation number
next to the equation.Robert Stayton: param.xweb; param.entAdd equation.number.properties.HTMLThe following changes have been made to the
html code
since the 1.75.2 release.Mauritz Jeanson: block.xslModified acknowledgements template to avoid invalid output (<p> in <p>).Mauritz Jeanson: titlepage.xslAdded default sidebar attribute-sets.Robert Stayton: table.xslFix bug 2979166 able - Attribute @rowheader not workingRobert Stayton: footnote.xslFix bug 3033191 footnotes in html tables.Mauritz Jeanson: inline.xslImproved glossterm auto-linking by using keys. The old code was inefficient when processing documents
with many inline glossterms.Robert Stayton: docbook.css.xml; verbatim.xslFix bug 2844927 Validity error for callout bugs.Robert Stayton: formal.xslConvert formal.object.heading to respect make.clean.html param.Robert Stayton: titlepage.templates.xml; block.xslFix bug 2840768 sidebar without title inserts empty b tag.Mauritz Jeanson: docbook.xslMoved the template that outputs <base> so that the base URI also applies to relative CSS paths that come later.
See patch #2896121.Jirka Kosek: autoidx-kosek.xslUpgraded to use common entities. Fixed bug when some code used @sortas and some not for grouping/sorting of indexterms.Robert Stayton: chunk-code.xslfix bug 2948363 generated filename for refentry not unique, when
used in a set.Robert Stayton: component.xslFix missing "Chapter n" label when use chapter/info/title.Robert Stayton: table.xslRow recursion turned off if no @morerows attributes in the table.
This will prevent failure on long table (with no @morerows) due
to excessive depth of recursion.Robert Stayton: autotoc.xsl; docbook.css.xmlSupport make.clean.html in autotoc.xsl.Robert Stayton: docbook.css.xml; block.xslAdd support for make.clean.html setting in block elements.Robert Stayton: docbook.css.xmlStock CSS styles for DocBook HTML output when 'make.clean.html' is non-zero.Robert Stayton: html.xslAdd templates for generating CSS files and links to them.Robert Stayton: param.xwebFix bugs in new entity references.Robert Stayton: chunk-common.xslList of Equations now includes on equations with titles.Robert Stayton: table.xslIf a colspec has a colname attribute, add it to the HTML col
element as a class attribute so it can be styled.Robert Stayton: formal.xslFix bug 2825842 where table footnotes not appearing in HTML-coded table.Robert Stayton: chunktoc.xslFix bug #2834826 where appendix inside part was not chunked as it should be.Mauritz Jeanson: chunktoc.xslAdded missing namespace declarations. Closes bug #2890069.Mauritz Jeanson: footnote.xslUpdated the template for footnote paras to use the 'paragraph' template. Closes bug #2803739.Keith Fahlgren: inline.xsl; lists.xslRemove <b> and <i> elements "discouraged in favor of style sheets" from
XHTML, XHTML 1.1 (and therefore EPUB) outputs by changing html2xhtml.xsl.
Fixes bug #2873153: No <b> and <i> tags in XHTML/EPUB
Added regression to EPUB specs:Mauritz Jeanson: inline.xslFixed bug #2844916 (don't output @target if ulink.target is empty).Keith Fahlgren: autoidx.xslFix a bug when using index.on.type: an 'index symbols' section was created
even if that typed index didn't include any symbols (they were in the other types).ManpagesThe following changes have been made to the
manpages code
since the 1.75.2 release.Mauritz Jeanson: other.xslModified the write.stubs template so that the section directory name is not output twice. Should fix bug #2831602.
Also ensured that $lang is added to the .so path (when man.output.lang.in.name.enabled=1).Mauritz Jeanson: docbook.xsl; other.xslFixed bug #2412738 (apostrophe escaping) by applying the submitted patch.Norman Walsh: block.xsl; endnotes.xslFix bug where simpara in footnote didn't work. Patch by Jonathan Nieder, jrnieder@gmail.comdleidert: lists.xslFix two indentation issues: In the first case there is no corresponding .RS
macro (Debian #519438, sf.net 2793873). In the second case an .RS instead of
the probably intended .sp leads to an indentation bug (Debian #527309,
sf.net #2642139).EpubThe following changes have been made to the
epub code
since the 1.75.2 release.Keith Fahlgren: bin/spec/examples/AMasqueOfDays.epub; docbook.xsl; bin/spec/epub_spec.rbResolve some actual regressions in date output spotted by more recent versions of epubcheckKeith Fahlgren: docbook.xslUpdated mediaobject selection code that better uses roles (when available); based on contributons by Glenn McDonaldKeith Fahlgren: bin/spec/epub_regressions_spec.rb; docbook.xslEnsure that NCX documents are always outputted with a default namespace
to prevent problems with the kindlegen machineryKeith Fahlgren: bin/spec/epub_regressions_spec.rb; bin/spec/files/partintro.xml; docbook.x⋯Adding support for partintros with sect2s, 3s, etcKeith Fahlgren: docbook.xslAdding param to workaround horrific ADE bug with the inability to process <br>Keith Fahlgren: docbook.xslAdd support for authorgroup/author in OPF metadata (via Michael Wiedmann)Keith Fahlgren: bin/spec/epub_regressions_spec.rbRemove <b> and <i> elements "discouraged in favor of style sheets" from
XHTML, XHTML 1.1 (and therefore EPUB) outputs by changing html2xhtml.xsl.
Fixes bug #2873153: No <b> and <i> tags in XHTML/EPUB
Added regression to EPUB specs:Keith Fahlgren: bin/lib/docbook.rb; bin/spec/files/DejaVuSerif-Italic.otf; docbook.xsl; bi⋯This resolves bug #2873142, Please add support for multiple embedded fonts
If you navigate to a checkout of DocBook-XSL and go to:
xsl/epub/bin/spec/files
You can now run the following command:
../../dbtoepub -f DejaVuSerif.otf -f DejaVuSerif-Italic.otf -c test.css
-s test_cust.xsl orm.book.001.xml
In dbtoepub, the following option can be used more than once:
-f, --font [OTF FILE] Embed OTF FILE in .epub.
The underlying stylesheet now accepts a comma-separated list of font file
names rather than just one as the RENAMED epub.embedded.fonts ('s' added).
The runnable EPUB spec now includes:
- should be valid .epub after including more than one embedded fontKeith Fahlgren: docbook.xslImprove the selection of cover images when working in DocBook 4.x land (work in progress)Keith Fahlgren: bin/spec/epub_regressions_spec.rb; docbook.xslImprove the quality of the OPF spine regression by ensuring that the spine
elements for deeply nested refentries are in order and adjacent to their
opening wrapper XHTML chunk.Keith Fahlgren: bin/spec/epub_regressions_spec.rb; docbook.xsl; bin/spec/files/orm.book.00⋯Add more careful handling of refentries to ensure that they always appear in the opf:spine.
This was only a problem when refentries were pushed deep into the hierarchy (like inside
a sect2), but presented navigational problems for many reading systems (despite the
correct NCX references). This may *not* be the best solution, but attacking a better
chunking strategy for refentries was too big a nut to crack at this time.EclipseThe following changes have been made to the
eclipse code
since the 1.75.2 release.Mauritz Jeanson: eclipse3.xslAdded a stylesheet module that generates plug-ins conforming to the standard (OSGi-based) Eclipse 3.x
architecture. The main difference to the older format is that metadata is stored in a separate
manifest file. The module imports and extends the existing eclipse.xsl module. Based on code
contributed in patch #2624668.ParamsThe following changes have been made to the
params code
since the 1.75.2 release.Robert Stayton: draft.watermark.image.xmlFix bug 2922488 draft.watermark.image pointing to web resource.
Now the value is images/draft.png, and may require customization
for local resolution.Mauritz Jeanson: equation.number.properties.xmlCorrected refpurpose.Norman Walsh: paper.type.xmlAdded USlegal and USlegallandscape paper types.Jirka Kosek: highlight.xslthl.config.xmlAdded note about specifying location as URLRobert Stayton: docbook.css.source.xml; generate.css.header.xml; custom.css.source.xml; ma⋯Params to support generated CSS files.Robert Stayton: equation.number.properties.xmlNew attribute set for numbers appearing next to equations.XSL-XalanThe following changes have been made to the
xsl-xalan code
since the 1.75.2 release.dleidert: nbproject/genfiles.properties; nbproject/build-impl.xmlRebuild netbeans build files after adding missing Netbeans configuration to allow easier packaging for Debian.Release Notes: 1.75.2The following is a list of changes that have been made
since the 1.75.1 release.GentextThe following changes have been made to the
gentext code
since the 1.75.1 release.dleidert: locale/ja.xmlImproved Japanese translation for Note(s). Closes bug #2823965.dleidert: locale/pl.xmlPolish alphabet contains O with acute accent, not with grave accent. Closes bug #2823964.Robert Stayton: locale/ja.xmlFix translation of "index", per bug report 2796064.Robert Stayton: locale/is.xmlNew Icelandic locale file.CommonThe following changes have been made to the
common code
since the 1.75.1 release.Norman Walsh: stripns.xslSupport more downconvert casesRobert Stayton: titles.xslMake sure title inside info is used if no other title.FOThe following changes have been made to the
fo code
since the 1.75.1 release.Robert Stayton: pi.xslTurn off dbfo-need for fop1.extensions also, per bug #2816141.HTMLThe following changes have been made to the
html code
since the 1.75.1 release.Mauritz Jeanson: titlepage.xslOutput "Copyright" heading in XHTML too.Mauritz Jeanson: titlepage.xslAdded stylesheet.result.type test for copyright. Closes bug #2813289.Norman Walsh: htmltbl.xslRemove ambiguity wrt @span, @rowspan, and @colspanManpagesThe following changes have been made to the
manpages code
since the 1.75.1 release.Mauritz Jeanson: endnotes.xslAdded normalize-space() for ulink content. Closes bug #2793877.Mauritz Jeanson: docbook.xslAdded stylesheet.result.type test for copyright. Closes bug #2813289.EpubThe following changes have been made to the
epub code
since the 1.75.1 release.Keith Fahlgren: bin/dbtoepub; bin/lib/docbook.rbCorrected bugs caused by path and file assumptions were not metKeith Fahlgren: bin/lib/docbook.rb; docbook.xslCleaning up hardcoded values into parameters and fixing Ruby library to pass them properly; all thanks to patch from Liza DalyProfilingThe following changes have been made to the
profiling code
since the 1.75.1 release.Robert Stayton: profile.xslFix bug 2815493 missing exsl.node.set.available parameter.XSL-SaxonThe following changes have been made to the
xsl-saxon code
since the 1.75.1 release.Mauritz Jeanson: src/com/nwalsh/saxon/ColumnUpdateEmitter.java; src/com/nwalsh/saxon/Colum⋯Added fixes so that colgroups in the XHTML namespace are processed properly.XSL-XalanThe following changes have been made to the
xsl-xalan code
since the 1.75.1 release.Mauritz Jeanson: nbproject/project.xmlAdded missing NetBeans configuration.Release Notes: 1.75.1This release includes bug fixes.The following is a list of changes that have been made since the 1.75.0 release.FOThe following changes have been made to the fo code since the 1.75.0 release.Keith Fahlgren: block.xslSwitching to em dash for character before attribution in epigraph; resolves Bug #2793878Robert Stayton: lists.xslFixed bug 2789947, id attribute missing on simplelist fo output.HTMLThe following changes have been made to the
html code
since the 1.75.0 release.Keith Fahlgren: block.xslSwitching to em dash for character before attribution in epigraph; resolves Bug #2793878Robert Stayton: lists.xslFixed bug 2789678: apply-templates line accidentally deleted.EpubThe following changes have been made to the
epub code
since the 1.75.0 release.Keith Fahlgren: bin/spec/epub_regressions_spec.rb; docbook.xslAdded regression and fix to correct "bug" with namespace-prefixed container elements in META-INF/container.xml ; resolves Issue #2790017Keith Fahlgren: bin/spec/epub_regressions_spec.rb; bin/spec/files/onegraphic.xinclude.xml;⋯Another attempt at flexible named entity and XInclude processingKeith Fahlgren: bin/lib/docbook.rbTweaking solution to Bug #2750442 following regression reported by Michael Wiedmann.ParamsThe following changes have been made to the
params code
since the 1.75.0 release.Mauritz Jeanson: highlight.source.xmlUpdated documentation to reflect changes made in r8419.Release Notes: 1.75.0This release includes important bug fixes and adds the following
significant feature changes:
GentextModifications to translations have been made. CommonAdded support for some format properties on tables using
HTML table markup. Added two new qanda.defaultlabel values so that numbered sections
and numbered questions can be distinguished. Satisfies
Feature Request #1539045.Added code to handle acknowledgements in book and part. The element is processed
similarly to dedication. All acknowledgements will appear as front matter, after
any dedications.FOThe inclusion of highlighting code has been simplified.Add support for pgwide on informal objects.Added a new parameter, bookmarks.collapse, that controls the initial state of the bookmark tree. Closes FR #1792326.Add support for more dbfo processing instructions.Add new variablelist.term.properties to format terms, per request # 1968513.Add support for @width on screen and programlisting, fixes bug #2012736.Add support for writing-mode="rl-tb" (right-to-left) in FO outputs. Add writing.mode param for FO output.HTMLConvert all calls to class.attribute to calls to common.html.attributes to support dir, lang, and title attributes in html output for all elements. Fulfills feature request #1993833.Inclusion of highlighting code was simplified. Only one import is now necessary.Add new param index.links.to.section.Add support for the new index.links.to.section param which permits precise links to indexterms in HTML output rather than to the sectiontitle.ePubSlightly more nuanced handling of imageobject alternatives and better support in dbtoepub for XIncludes and ENTITYs to resolve Issue #2750442 reported by Raphael Hertzog.Added a colon after an abstract/title when mapping into the dc:description for OPF metadata in ePub output to help the flat text have more pseudo-semantics (sugestions from Michael Wiedmann)Added DocBook subjectset -> OPF dc:subject mapping and testsAdded DocBook date -> OPF dc:date mapping and testsAdded DocBook abstract -> OPF dc:description mapping and testsAdded --output option to dbtoepub based on user requestHTMLHelpAdd support for generating olink target database for htmlhelp files.ParamsAdd default setting for @rules attribute on HTML markup tables.Added a new parameter, bookmarks.collapse, that controls the initial state of the bookmark tree. When the parameter has a non-zero value (the default), only the top-level bookmarks are displayed initially. Otherwise, the whole tree of bookmarks is displayed. This is implemented for FOP 0.9X. Closes FR #1792326.Add new variablelist.term.properties to format terms, per request # 1968513.Add two new qanda.defaultlabel values so that numbered sections and numbered questions can be distinguished. Satisfies Feature Request #1539045.Add param to control whether an indexentry links to a sectiontitle or to the precise location of the indexterm.New attribute list for glossentry in glossary.New parameter to support @width on programlisting and screen.Add attribute-sets for formatting glossary terms and defs.HighlightingInclusion of highlighting code was simplified. Only one import is now necessary.The following is a list of changes that have been made
since the 1.74.3 release.GentextThe following changes have been made to the
gentext code
since the 1.74.3 release.Robert Stayton: locale/sv.xml; locale/ja.xml; locale/pl.xmlCheck in translations of Legalnotice submitted on mailing list.Robert Stayton: locale/es.xmlFix spelling errors in Acknowledgements entries.Robert Stayton: locale/es.xmlCheck in translations for 4 elements submitted through docbook-apps
message of 14 April 2009.David Cramer: locale/zh.xml; locale/ca.xml; locale/ru.xml; locale/ga.xml; locale/gl.xml; l⋯Internationalized punctuation in glosssee and glossseealsoRobert Stayton: MakefileCheck in fixes for DSSSL gentext targets from submitted patch #1689633.Robert Stayton: locale/uk.xmlCheck in major update submitted with bug report #2008524.Robert Stayton: locale/zh_tw.xmlCheck in fix to Note string submitted in bug #2441051.Robert Stayton: locale/ru.xmlCheckin typo fix submitted in bug #2453406.CommonThe following changes have been made to the
common code
since the 1.74.3 release.Robert Stayton: gentext.xslFix extra generated space when xrefstyle includes 'nopage'.Robert Stayton: table.xslAdd support for some format properties on tables using
HTML table markup. These include:
- frame attribute on table (or uses $default.table.frame parameter).
- rules attribute on table (or uses $default.table.rules parameter).
- align attribute on td and th
- valign attribute on td and th
- colspan on td and th
- rowspan on td and th
- bgcolor on td and thRobert Stayton: olink.xslAdd placeholder template to massage olink hot text to make
customization easier, per Feature Request 1828608.Robert Stayton: targets.xslAdd support for collecting olink targets from a glossary
generated from a glossary.collection.Robert Stayton: titles.xslHandle firstterm like glossterm in mode="title.markup".Robert Stayton: titles.xslAdd match on info/title in title.markup templates where missing.Mauritz Jeanson: titles.xslChanged "ancestor::title" to "(ancestor::title and (@id or @xml:id))".
This enables proper formatting of inline elements in titles in TOCs,
as long as these inlines don't have id or xml:id attributes.Robert Stayton: labels.xslAdd two new qanda.defaultlabel values so that numbered sections
and numbered questions can be distinguished. Satisfies
Feature Request #1539045.Robert Stayton: stripns.xsl; pi.xslConvert function-available(exsl:node-set) to use the new param
so Xalan bug is isolated.Mauritz Jeanson: titles.xslAdded fixes for bugs #2112656 and #1759205:
1. Reverted mistaken commits r7485 and r7523.
2. Updated the template with match="link" and mode="no.anchor.mode" so that
@endterm is used if it exists and if the link has no content.Mauritz Jeanson: titles.xslAdded code to handle acknowledgements in book and part. The element is processed
similarly to dedication. All acknowledgements will appear as front matter, after
any dedications.Robert Stayton: olink.xslFix bug #2018717 use.local.olink.style uses wrong gentext context.Robert Stayton: olink.xslFix bug #1787167 incorrect hot text for some olinks.Robert Stayton: common.xslFix bug #1669654 Broken output if copyright <year> contains a range.Robert Stayton: labels.xslFix bug in labelling figure inside appendix inside article inside book.FOThe following changes have been made to the
fo code
since the 1.74.3 release.Jirka Kosek: highlight.xslInclusion of highlighting code was simplified. Only one import is now necessary.Robert Stayton: fop1.xslAdd the new fop extensions namespace declaration, in case FOP
extension functions are used.Robert Stayton: formal.xslAdd support for pgwide on informal objects.Robert Stayton: docbook.xslFixed spurious closing quote on line 134.Robert Stayton: docbook.xsl; autoidx-kosek.xsl; autoidx.xslConvert function-available for node-set() to use
new $exsl.node.set.available param in test.David Cramer: xref.xslSuppress extra space after xref when xrefstyle='select: label nopage' (#2740472)Mauritz Jeanson: pi.xslFixed doc bug for row-height.David Cramer: glossary.xslInternationalized punctuation in glosssee and glossseealsoRobert Stayton: param.xweb; param.ent; htmltbl.xsl; table.xslAdd support for some format properties on tables using
HTML table markup. These include:
- frame attribute on table (or uses $default.table.frame parameter).
- rules attribute on table (or uses $default.table.rules parameter).
- align attribute on td and th
- valign attribute on td and th
- colspan on td and th
- rowspan on td and th
- bgcolor on td and thRobert Stayton: table.xslAdd support bgcolor in td and th
elements in HTML table markup.Robert Stayton: htmltbl.xslAdd support for colspan and rowspan and bgcolor in td and th
elements in HTML table markup.Robert Stayton: param.xwebFix working of page-master left and right margins.Mauritz Jeanson: param.xweb; param.ent; fop1.xslAdded a new parameter, bookmarks.collapse, that controls the initial state of the bookmark tree. When the parameter has a non-zero value (the default), only the top-level bookmarks are displayed initially. Otherwise, the whole tree of bookmarks is displayed. This is implemented for FOP 0.9X. Closes FR #1792326.Robert Stayton: table.xsl; pi.xslAdd support for dbfo row-height processing instruction, like that in dbhtml.Robert Stayton: lists.xslAdd support for dbfo keep-together processing instruction for
entire list instances.Robert Stayton: lists.xsl; block.xslAdd support fo dbfo keep-together processing instruction to
more blocks like list items and paras.Robert Stayton: lists.xsl; param.xweb; param.entAdd new variablelist.term.properties to format terms, per request # 1968513.Robert Stayton: inline.xslIn simple.xlink, rearrange order of processing.Robert Stayton: xref.xslHandle firstterm like glossterm in mode="xref-to".Robert Stayton: glossary.xsl; xref.xsl; pi.xsl; footnote.xslImplement simple.xlink for glosssee and glossseealso so they can use
other types of linking besides otherterm.Robert Stayton: qandaset.xslAdd two new qanda.defaultlabel values so that numbered sections and numbered questions can be distinguished. Satisfies Feature Request #1539045.Robert Stayton: titlepage.xslFor the booktitle templates, I changed info/title to book/info/title
so other element's titles will not be affected.Robert Stayton: xref.xsl; verbatim.xslUse param exsl.node.set.available to test for function.Robert Stayton: param.xweb; param.ent; footnote.xslStart using new param exsl.node.set.available to work around Xalan bug.Robert Stayton: titlepage.templates.xmlAdd comment on use of t:predicate for editor to prevent
extra processing of multiple editors. Fixes bug 2687842.Robert Stayton: xref.xsl; autoidx.xslAn indextermprimary, secondary, or tertiary element with an id or xml:id
now outputs that ID, so that index entries can be cross referenced to.Mauritz Jeanson: synop.xslAdded modeless template for ooclass|oointerface|ooexception.
Closes bug #1623468.Robert Stayton: xref.xslAdd template with match on indexterm in mode="xref-to" to fix bug 2102592.Robert Stayton: xref.xslNow xref to qandaentry will use the label element in a question for
the link text if it has one.Robert Stayton: inline.xslAdd id if specified from @id to output for quote and phrase so
they can be xref'ed to.Robert Stayton: xref.xslAdd support for xref to phrase, simpara, anchor, and quote.
This assumes the author specifies something using xrefstyle since
the elements don't have ordinary link text.Robert Stayton: toc.xslFix bug in new toc templates.Mauritz Jeanson: titlepage.xsl; component.xsl; division.xsl; xref.xsl; titlepage.templates⋯Added code to handle acknowledgements in book and part. The element is processed
similarly to dedication. All acknowledgements will appear as front matter, after
any dedications.Robert Stayton: toc.xslRewrite toc templates to support an empty toc or populated toc
in all permitted contexts. Same for lot elements.
This fixes bug #1595969 for FO outputs.Robert Stayton: index.xslFix indents for seealsoie so they are consistent.Mauritz Jeanson: param.xwebRemoved duplicate (monospace.font.family).Robert Stayton: param.xweb; param.entAdd glossentry.list.item.properties.Robert Stayton: param.xweb; param.entAdd monospace.verbatim.font.width param to support @width on programlisting.Robert Stayton: verbatim.xslPut programlisting in fo:block-container with writing-mode="lr-tb"
when text direction is right to left because all program languages
are left-to-right.Robert Stayton: verbatim.xslAdd support for @width on screen and programlisting, fixes bug #2012736.Robert Stayton: xref.xslFix bug #1973585 xref to para with xrefstyle not handled correctly.Mauritz Jeanson: block.xslAdded support for acknowledgements in article.
Support in book/part remains to be added.Robert Stayton: xref.xslFix bug #1787167 incorrect hot text for some olinks.Robert Stayton: fo.xslAdd writing-mode="tb-rl" as well since some XSL-FO processors support it.Robert Stayton: autotoc.xsl; lists.xsl; glossary.xsl; fo.xsl; table.xsl; pagesetup.xslAdd support for writing-mode="rl-tb" (right-to-left) in FO outputs.
Changed instances of margin-left to margin-{$direction.align.start}
and margin-right to margin-{$direction.align.end}. Those direction.align
params are computed from the writing mode value in each locale's
gentext key named 'writing-mode', introduced in 1.74.3 to add
right-to-left support to HTML outputs.Robert Stayton: param.xweb; param.entAdd attribute-sets for formatting glossary terms and defs.Robert Stayton: param.xweb; param.entAdd writing.mode param for FO output.Robert Stayton: autotoc.xslFix bug 1546008: in qandaentry in a TOC, use its blockinfo/titleabbrev or blockinfo/title
instead of question, if available. For DocBook 5, use the info versions.Keith Fahlgren: verbatim.xslAdd better pointer to README for XSLTHLKeith Fahlgren: verbatim.xslMore tweaking the way that XSLTHL does or does not get calledKeith Fahlgren: verbatim.xslAlternate attempt at sanely including/excluding XSLTHT codeHTMLThe following changes have been made to the
html code
since the 1.74.3 release.Robert Stayton: lists.xslRemoved redundant lang and title attributes on list element inside
div element for lists.Robert Stayton: inline.xsl; titlepage.xsl; division.xsl; toc.xsl; sections.xsl; table.xsl;⋯Convert all calls to class.attribute to calls to common.html.attributes
to support dir, lang, and title attributes in html output for all elements.
Fulfills feature request #1993833.Robert Stayton: chunk-common.xslFix bug #2750253 wrong links in list of figures in chunk.html
when target html is in a subdirectory and dbhtml filename used.Jirka Kosek: highlight.xslInclusion of highlighting code was simplified. Only one import is now necessary.Robert Stayton: chunk-common.xsl; chunktoc.xsl; docbook.xsl; chunk-changebars.xsl; autoidx⋯Convert function-available for node-set() to use
new $exsl.node.set.available param in test.Mauritz Jeanson: pi.xslFixed doc bug for row-height.David Cramer: glossary.xslInternationalized punctuation in glosssee and glossseealsoRobert Stayton: lists.xsl; html.xsl; block.xslMore elements get common.html.attributes.
Added locale.html.attributes template which does the lang,
dir, and title attributes, but not the class attribute
(used on para, for example).Robert Stayton: lists.xslReplace more literal class atts with mode="class.attribute" to support
easier customization.Robert Stayton: glossary.xslSupport olinking in glosssee and glossseealso.Robert Stayton: inline.xslIn simple.xlink, rearrange order of processing.Robert Stayton: xref.xslHandle firstterm like glossterm in mode="xref-to".Robert Stayton: lists.xsl; html.xsl; block.xslAdded template named common.html.attributes to output
class, title, lang, and dir for most elements.
Started adding it to some list and block elements.Robert Stayton: qandaset.xslAdd two new qanda.defaultlabel values so that numbered sections
and numbered questions can be distinguished. Satisfies
Feature Request #1539045.Robert Stayton: param.xweb; chunk-code.xsl; param.ent; xref.xsl; chunkfast.xsl; verbatim.x⋯Use new param exsl.node.set.available to test, handles Xalan bug.Robert Stayton: autoidx.xslUse named anchors for primary, secondary, and tertiary ids so
duplicate entries with different ids can still have an id output.Robert Stayton: param.xweb; param.entAdd new param index.links.to.section.Robert Stayton: xref.xsl; autoidx.xslPass through an id on primary, secondary, or tertiary to
the indexentry, so that one could link to an indexentry.
You can't link to the id on an indexterm because that is
used to place the main anchor in the text flow.Robert Stayton: autoidx.xslAdd support for the new index.links.to.section param which permits
precise links to indexterms in HTML output rather than to
the sectiontitle.Mauritz Jeanson: synop.xslAdded modeless template for ooclass|oointerface|ooexception.
Closes bug #1623468.Robert Stayton: qandaset.xslMake sure a qandaset has an anchor, even when it has no title,
because it may be referenced in a TOC or xref.
Before, the anchor was output by the title, but there was no
anchor if there was no title.Robert Stayton: xref.xslAdd a template for indexterm with mode="xref-to" to fix bug 2102592.Robert Stayton: xref.xslNow xref to qandaentry will use the label element in a question for
the link text if it has one.Robert Stayton: qandaset.xsl; html.xslCreate separate templates for computing label of question and answer
in a qandaentry, so such can be used for the alt text of an xref
to a qandaentry.Robert Stayton: inline.xsl; xref.xslNow support xref to phrase, simpara, anchor, and quote,
most useful when an xrefstyle is used.Robert Stayton: toc.xslRewrite toc templates to support an empty toc or populated toc
in all permitted contexts. Same for lot elements.
This fixes bug #1595969 for HTML outputs.Mauritz Jeanson: titlepage.xsl; component.xsl; division.xsl; xref.xsl; titlepage.templates⋯Added code to handle acknowledgements in book and part. The element is processed
similarly to dedication. All acknowledgements will appear as front matter, after
any dedications.Robert Stayton: index.xslRewrote primaryie, secondaryie and tertiaryie templates to handle
nesting of elements and seeie and seealsoie, as reported in
bug # 1168912.Robert Stayton: autotoc.xslFix simplesect in toc problem.Robert Stayton: verbatim.xslAdd support for @width per bug report #2012736.Robert Stayton: formal.xsl; htmltbl.xslFix bug #1787140 HTML tables not handling attributes correctly.Robert Stayton: param.xwebMove writing-mode param.Keith Fahlgren: refentry.xslRemove a nesting of <p> inside <p> for refclass (made XHTML* invalid, made HTML silly)Robert Stayton: table.xslFix bug #1945872 to allow passthrough of colwidth values to
HTML table when no tablecolumns.extension is available and
when no instance of * appears in the table's colspecs.Mauritz Jeanson: block.xslAdded support for acknowledgements in article.
Support in book/part remains to be added.Robert Stayton: chunk-common.xslFix bug #1787167 incorrect hot text for some olinks.Robert Stayton: qandaset.xslFix bug 1546008: in qandaentry in a TOC, use its blockinfo/titleabbrev or blockinfo/title
instead of question, if available. For DocBook 5, use the info versions.Robert Stayton: chunktoc.xslAdd support for generating olinkdatabase when using chunktoc.xsl.Keith Fahlgren: verbatim.xslAdd better pointer to README for XSLTHLKeith Fahlgren: verbatim.xslAnother stab at fixing the stupid XSLTHT includes across processors (Saxon regression reported by Sorin Ristache)Keith Fahlgren: verbatim.xslMore tweaking the way that XSLTHL does or does not get calledKeith Fahlgren: verbatim.xslAlternate attempt at sanely including/excluding XSLTHT codeManpagesThe following changes have been made to the
manpages code
since the 1.74.3 release.Robert Stayton: table.xslConvert function-available test for node-set() function to
test of $exsl.node.set.available param.Mauritz Jeanson: lists.xslAdded a template for bibliolist. Closes bug #1815916.ePubThe following changes have been made to the
epub code
since the 1.74.3 release.Keith Fahlgren: bin/spec/epub_regressions_spec.rb; bin/spec/files/onegraphic.xinclude.xml;⋯Slightly more nuanced handling of imageobject alternatives and better support in dbtoepub for XIncludes and ENTITYs to resolve Issue #2750442 reported by Raphael Hertzog.Keith Fahlgren: docbook.xslAdd a colon after an abstract/title when mapping into the dc:description for OPF metadata in ePub output to help the flat text have more pseudo-semantics (sugestions from Michael Wiedmann)Keith Fahlgren: bin/spec/epub_regressions_spec.rb; docbook.xsl; bin/spec/files/de.xmlCorrectly set dc:language in OPF metadata when i18nizing. Closes Bug #2755150Keith Fahlgren: bin/spec/epub_regressions_spec.rb; docbook.xslCorrected namespace declarations for literal XHTML elements to make them serialize "normally"Keith Fahlgren: docbook.xslBe a little bit more nuanced about datesKeith Fahlgren: docbook.xsl; bin/spec/epub_realbook_spec.rb; bin/spec/files/orm.book.001.x⋯Add DocBook subjectset -> OPF dc:subject mapping and testsKeith Fahlgren: docbook.xsl; bin/spec/epub_realbook_spec.rb; bin/spec/files/orm.book.001.x⋯Add DocBook date -> OPF dc:date mapping and testsKeith Fahlgren: docbook.xsl; bin/spec/epub_realbook_spec.rb; bin/spec/files/orm.book.001.x⋯Add DocBook abstract -> OPF dc:description mapping and testsRobert Stayton: docbook.xslCheck in patch submitted by user to add opf:file-as attribute
to dc:creator element.Keith Fahlgren: bin/dbtoepubAdding --output option to dbtoepub based on user requestKeith Fahlgren: docbook.xsl; bin/spec/epub_spec.rbCleaning and regularizing the generation of namespaced nodes for OPF, NCX, XHTML and other outputted filetypes (hat tip to bobstayton for pointing out the silly, incorrect code)Keith Fahlgren: bin/spec/epub_regressions_spec.rb; bin/spec/files/refclass.xmlRemove a nesting of <p> inside <p> for refclass (made XHTML* invalid, made HTML silly)Keith Fahlgren: bin/spec/epub_regressions_spec.rb; bin/spec/files/blockquotepre.xmlAdded regression test and fix for XHTML validation problem with <a>s added inside <blockquote>; This potentially causes another problem (where something is referenced by has no anchor, but someone reporting that should cause the whole <a id='thing'/> thing to be reconsidered with modern browsers in mind.HTMLHelpThe following changes have been made to the
htmlhelp code
since the 1.74.3 release.Robert Stayton: htmlhelp-common.xslAdd support for generating olink target database for htmlhelp files.ParamsThe following changes have been made to the
params code
since the 1.74.3 release.Robert Stayton: default.table.rules.xmlAdd default setting for @rules attribute on HTML markup tables.Mauritz Jeanson: bookmarks.collapse.xmlAdded a new parameter, bookmarks.collapse, that controls the initial state
of the bookmark tree. When the parameter has a non-zero value (the default),
only the top-level bookmarks are displayed initially. Otherwise, the whole
tree of bookmarks is displayed.
This is implemented for FOP 0.9X. Closes FR #1792326.Robert Stayton: variablelist.term.properties.xmlAdd new variablelist.term.properties to format terms, per
request # 1968513.Robert Stayton: qanda.defaultlabel.xmlAdd two new qanda.defaultlabel values so that numbered sections
and numbered questions can be distinguished. Satisfies
Feature Request #1539045.Robert Stayton: index.links.to.section.xmlChange default to 1 to match past behavior.Robert Stayton: exsl.node.set.available.xmlIsolate this text for Xalan bug regarding exsl:node-set available.
If it is ever fixed in Xalan, just fix it here.Robert Stayton: index.links.to.section.xmlAdd param to control whether an indexentry links to
a sectiontitle or to the precise location of the
indexterm.Robert Stayton: glossentry.list.item.properties.xmlNew attribute list for glossentry in glossary.Robert Stayton: monospace.verbatim.font.width.xmlNew parameter to support @width on programlisting and screen.Mauritz Jeanson: highlight.source.xmlUpdated and reorganized the description.Robert Stayton: page.margin.outer.xml; page.margin.inner.xmlAdd caveat about XEP bug when writing-mode is right-to-left.Robert Stayton: article.appendix.title.properties.xml; writing.mode.xml; body.start.indent⋯Change 'left' to 'start' and 'right' to 'end' to support right-to-left
writing mode.Robert Stayton: glossdef.block.properties.xml; glossdef.list.properties.xml; glossterm.blo⋯Add attribute-sets for formatting glossary terms and defs.Robert Stayton: glossterm.separation.xmlClarify the description.Robert Stayton: make.year.ranges.xmlNow handles year element containing a comma or dash without error.HighlightingThe following changes have been made to the
highlighting code
since the 1.74.3 release.Jirka Kosek: READMEInclusion of highlighting code was simplified. Only one import is now necessary.Keith Fahlgren: READMEAdding XSLTHL readmeKeith Fahlgren: common.xslAlternate attempt at sanely including/excluding XSLTHT codeXSL-SaxonThe following changes have been made to the
xsl-saxon code
since the 1.74.3 release.Mauritz Jeanson: src/com/nwalsh/saxon/Text.javaAdded a fix that prevents output of extra blank line.
Hopefully this closes bug #894805.XSL-XalanThe following changes have been made to the
xsl-xalan code
since the 1.74.3 release.Mauritz Jeanson: src/com/nwalsh/xalan/Text.javaAdded a fix that prevents output of extra blank line.
Hopefully this closes bug #894805.Release Notes: 1.74.3This release fixes some bugs in the 1.74.2 release.See highlighting/README for XSLTHL usage instructions.Release Notes: 1.74.2This release fixes some bugs in the 1.74.1 release.Release Notes: 1.74.1This release includes important bug fixes and adds the following
significant feature changes:
GentextKirghiz locale added and Chinese translations have been simplified.Somme support for gentext and right-to-left languages has been added.FOVarious bugs have been resolved. Support for a new processing instruction: dbfo funcsynopsis-style has been added. Added new param email.mailto.enabled for FO output. Patch from Paolo Borelli. Support for documented metadata in fop1 mode has been added. HighlightingSupport for the latest version of XSLTHL 2.0 and some new language syntaxes have been added to a variety of outputs.ManpagesAdded man.output.better.ps.enabled param (zero default). It non-zero, no such
markup is embedded in generated man pages, and no enhancements are
included in the PostScript output generated from those man pages
by the man -Tps command.HTMLSupport for writing.mode to set text direction and alignment based on document locale has been added.Added a new top-level stylesheet module, chunk-changebars.xsl, to be
used for generating chunked output with highlighting based on change
(@revisionflag) markup. The module imports/includes the standard chunking
and changebars templates and contains additional logic for chunked output.
See FRs #1015180 and #1819915.ePubCovers now look better in Adobe Digital Editions thanks to a patch from Paul Norton of AdobeCover handling now more generic (including limited DocBook 5.0 cover support thanks to patch contributed by Liza Daly.Cover markup now carries more reliably into files destined for .mobi and the Kindle.dc:identifiers are now generated from more types of numbering schemes. Both SEO and semantic structure of chunked ePub output by ensuring that we always send out one and only one h1 in each XHTML chunk.Primitive support for embedding a single font added.Support for embedding a CSS customizations added.RoundtripSupport for imagedata-metadata and table as images added.Support for imagedata-metadata and legalnotice as images added.Paramsman.output.better.ps.enabled added for Manpages output writing.mode.xml added to set text direction.Added new param email.mailto.enabled for FO output.
Patch from Paolo Borelli. Closes #2086321.highlight.source upgraded to support the latest version of XSLTHL 2.0.The following is a list of changes that have been made since the 1.74.0 release.GentextThe following changes have been made to the gentext code since the 1.74.0 release.Michael(tm) Smith: locale/ky.xml; Makefilenew Kirghiz locale from Ilyas BakirovMauritz Jeanson: locale/en.xmlAdded "Acknowledgements".Dongsheng Song: locale/zh_cn.xmlSimplified Chinese translation.Robert Stayton: locale/lv.xml; locale/ca.xml; locale/pt.xml; locale/tr.xml; locale/af.xml;⋯Add writing-mode gentext string to support right-to-left languages.FOThe following changes have been made to the fo code since the 1.74.0 release.David Cramer: footnote.xslAdded a check to confirm that a footnoteref's linkend points to a footnote. Stylesheets stop processing if not and provide a useful error message.Mauritz Jeanson: spaces.xslConvert spaces to fo:leader also in elements in the DB 5 namespace.Mauritz Jeanson: pi.xsl; synop.xslAdded support for a new processing instruction: dbfo funcsynopsis-style.
Closes bug #1838213.Michael(tm) Smith: inline.xsl; param.xweb; param.entAdded new param email.mailto.enabled for FO output.
Patch from Paolo Borelli. Closes #2086321.Mauritz Jeanson: docbook.xslAdded support for document metadata for fop1 (patch #2067318).Jirka Kosek: param.ent; param.xweb; highlight.xslUpgraded to support the latest version of XSLTHL 2.0
-- nested markup in highlited code is now processed
-- it is no longer needed to specify path XSLTHL configuration file using Java property
-- support for new languages, including Perl, Python and Ruby was addedHTMLThe following changes have been made to the html code since the 1.74.0 release.Robert Stayton: param.xweb; docbook.xsl; param.ent; html.xslAdd support for writing.mode to set text direction and alignment based on document locale.Mauritz Jeanson: chunk-changebars.xslAdded a new top-level stylesheet module, chunk-changebars.xsl, to be
used for generating chunked output with highlighting based on change
(@revisionflag) markup. The module imports/includes the standard chunking
and changebars templates and contains additional logic for chunked output.
See FRs #1015180 and #1819915.ManpagesThe following changes have been made to the manpages code since the 1.74.0 release.Michael(tm) Smith: docbook.xslPut the following at the top of generated roff for each page:
\" t
purpose is to explicitly tell AT&T troff that the page needs to be
pre-processed through tbl(1); groff can figure it out
automatically, but apparently AT&T troff needs to be explicitly toldePubThe following changes have been made to the epub code since the 1.74.0 release.Keith Fahlgren: docbook.xslPatch from Paul Norton of Adobe to get covers to look better in Adobe Digital EditionsKeith Fahlgren: bin/spec/epub_regressions_spec.rb; bin/spec/files/v5cover.xml; bin/spec/sp⋯Patch contributed by Liza Daly to make ePub cover handling more generic. Additionally
DocBook 5.0's <cover> now has some limited support:
- should reference a cover in the OPF guide for a DocBook 5.0 test documentKeith Fahlgren: bin/spec/files/isbn.xml; bin/spec/files/issn.xml; bin/spec/files/biblioid.⋯Liza Daly reported that the dc:identifer-generation code was garbage (she was right).
Added new tests:
- should include at least one dc:identifier
- should include an ISBN as URN for dc:identifier if an ISBN was in the metadata
- should include an ISSN as URN for dc:identifier if an ISSN was in the metadata
- should include an biblioid as a dc:identifier if an biblioid was in the metadata
- should include a URN for a biblioid with @class attribute as a dc:identifier if an biblioid was in the metadataKeith Fahlgren: docbook.xsl; bin/spec/epub_spec.rbImprove both SEO and semantic structure of chunked ePub output by ensuring that
we always send out one and only one h1 in each XHTML chunk.
DocBook::Epub
- should include one and only one <h1> in each HTML file in rendered ePub files
for <book>s
- should include one and only one <h1> in each HTML file in rendered ePub files
for <book>s even if they do not have section markupKeith Fahlgren: docbook.xsl; bin/spec/epub_realbook_spec.rb; bin/spec/files/orm.book.001.x⋯Adding better support for covers in epub files destined for .mobi and the KindleKeith Fahlgren: bin/dbtoepub; bin/lib/docbook.rb; bin/spec/files/DejaVuSerif.otf; docbook.⋯Adding primitive support for embedding a single fontKeith Fahlgren: bin/dbtoepub; bin/lib/docbook.rb; bin/spec/files/test_cust.xsl; bin/spec/e⋯Adding support for user-specified customization layers in dbtoepubKeith Fahlgren: bin/dbtoepub; bin/spec/epub_regressions_spec.rb; bin/lib/docbook.rb; bin/s⋯Adding CSS support to .epub target & dbtoepub:
-c, --css [FILE] Use FILE for CSS on generated XHTML.
DocBook::Epub
...
- should include a CSS link in HTML files when a CSS file has been provided
- should include CSS file in .epub when a CSS file has been provided
- should include a CSS link in OPF file when a CSS file has been providedRoundtripThe following changes have been made to the
roundtrip code
since the 1.74.0 release.Steve Ball: blocks2dbk.xsl; template.xml; template.dotadded support for imagedata-metadata
added support for table as imagesSteve Ball: blocks2dbk.xsl; normalise2sections.xsl; sections2blocks.xslImproved support for personname inlines.Steve Ball: blocks2dbk.xsl; blocks2dbk.dtd; template.xmlAdded support for legalnotice.Steve Ball: blocks2dbk.xsl; wordml2normalise.xsladded support for orgname in authorSteve Ball: specifications.xml; supported.xml; blocks2dbk.xsl; wordml2normalise.xsl; dbk2w⋯Updated specification.
to-DocBook: add cols attribute to tgroup
from-DocBook: fix for blockquotetitleParamsThe following changes have been made to the params since the 1.74.0 release.The change was to add man.output.better.ps.enabled parameter, with
its default value set to zero.
If the value of the man.output.better.ps.enabled parameter is
non-zero, certain markup is embedded in each generated man page
such that PostScript output from the man -Tps command for that
page will include a number of enhancements designed to improve the
quality of that output.
If man.output.better.ps.enabled is zero (the default), no such
markup is embedded in generated man pages, and no enhancements are
included in the PostScript output generated from those man pages
by the man -Tps command.
WARNING: The enhancements provided by this parameter rely on
features that are specific to groff (GNU troff) and that are not
part of "classic" AT&T troff or any of its derivatives. Therefore,
any man pages you generate with this parameter enabled will be
readable only on systems on which the groff (GNU troff) program is
installed, such as GNU/Linux systems. The pages will not not be
readable on systems on with the classic troff (AT&T troff) command
is installed.
NOTE: The value of this parameter only affects PostScript output
generated from the man command. It has no effect on output
generated using the FO backend.
TIP: You can generate PostScript output for any man page by
running the following command:
man FOO -Tps > FOO.ps
You can then generate PDF output by running the following command:
ps2pdf FOO.psRobert Stayton: writing.mode.xmlwriting mode param used to set text direction.Michael(tm) Smith: email.mailto.enabled.xmlAdded new param email.mailto.enabled for FO output.
Patch from Paolo Borelli. Closes #2086321.Jirka Kosek: highlight.source.xml; highlight.xslthl.config.xmlUpgraded to support the latest version of XSLTHL 2.0
-- nested markup in highlited code is now processed
-- it is no longer needed to specify path XSLTHL configuration file using Java property
-- support for new languages, including Perl, Python and Ruby was addedHighlightingThe following changes have been made to the
highlighting code
since the 1.74.0 release.Jirka Kosek: cpp-hl.xml; c-hl.xml; tcl-hl.xml; php-hl.xml; common.xsl; perl-hl.xml; delphi⋯Upgraded to support the latest version of XSLTHL 2.0
-- nested markup in highlited code is now processed
-- it is no longer needed to specify path XSLTHL configuration file using Java property
-- support for new languages, including Perl, Python and Ruby was addedRelease Notes: 1.74.0This release includes important bug fixes and adds the following
significant feature changes:
.epub targetPaul Norton (Adobe) and Keith Fahlgren(O'Reilly Media) have donated code that generates .epub documents from
DocBook input. An alpha-reference implementation in Ruby has also been provided..epub is an open standard of the The International Digital Publishing Forum (IDPF),
a the trade and standards association for the digital publishing industry. Read more about this target in epub/READMEXHTML 1.1 targetTo support .epub output, a strict XHTML 1.1 target has been added. The stylesheets for this output are
generated and are quite similar to the XHTML target.Gentext updatesA number of locales have been updated.Roundtrip improvementsTable, figure, template syncronization, and character style improvements have been made for WordML & Pages. Support added for OpenOffice.org.First implementation of a libxslt extensionA stylesheet extension for libxslt, written in Python, has been added.
The extension is a function for adjusting column widths in CALS tables. See
extensions/README.LIBXSLT for more information.The following is a list of changes that have been made
since the 1.73.2 release.GentextThe following changes have been made to the
gentext code
since the 1.73.2 release.Michael(tm) Smith: locale/id.xmlChecked in changes to Indonesion locale submitted by Euis Luhuanam a long time ago.Michael(tm) Smith: locale/lt.xmlAdded changes to Lithuanian locate submitted a long time back by Nikolajus Krauklis.Michael(tm) Smith: locale/hu.xmlfixed error in lowercase.alpha definition in Hungarian localeMichael(tm) Smith: locale/nb.xmlCorrected language code for nb locale, and restored missing "startquote" key.Michael(tm) Smith: locale/ja.xmlCommitted changes to ja locale file, from Akagi Kobayashi. Adds bracket quotes around many xref instances that did not have them
before.Michael(tm) Smith: Makefile"no" locale is now "nb"Michael(tm) Smith: locale/nb.xmlUpdate Norwegian Bokmål translation. Thanks to Hans F. Nordhaug.Michael(tm) Smith: locale/no.xml; locale/nb.xmlper message from Hans F. Nordhaug, correct identifier for
Norwegian Bokmål is "nb" (not "no") and has been for quite some
time now...Michael(tm) Smith: locale/ja.xmlConverted ja.xml source file to use real unicode characters so
that the actual glyphs so up when you edit it in a text editor
(instead of the character references).Michael(tm) Smith: locale/ja.xmlChecked in changes to ja.xml locale file. Thanks to Akagi Kobayashi.Michael(tm) Smith: locale/it.xmlChanges from Federico ZenithDongsheng Song: locale/zh_cn.xmlAdded missing translations.CommonThe following changes have been made to the
common code
since the 1.73.2 release.Michael(tm) Smith: l10n.xslAdded new template "l10.language.name" for retrieving the
English-language name of the lang setting of the current document.
Closes #1916837. Thanks to Simon Kennedy.Michael(tm) Smith: refentry.xslfixed syntax errorMichael(tm) Smith: refentry.xslfixed a couple of typosMichael(tm) Smith: refentry.xslrefined handling of cases where refentry "source" or "manual"
metadata is missing or when we use fallback content instead. We
now report a Warning if we use fallback content.Michael(tm) Smith: refentry.xsldon't use refmiscinfo@class=date value as fallback for refentry
"source" or "manual" metadata fieldsMichael(tm) Smith: refentry.xslMade reporting of missing refentry metadata more quiet:
- we no longer report anything if usable-but-not-preferred
metadata is found; we just quietly use whatever we manage to
find
- we now only report missing "source" metadata if the refentry
is missing BOTH "source name" and "version" metadata; if it
has one but not the other, we use whichever one it has and
don't report anything as missing
The above changes were made because testing with some "real world"
source reveals that some authors are intentionally choosing to use
"non preferred" markup for some metadata, and also choosing to
omit "source name" or "version" metadata in there DocBook XML. So
it does no good to give them pedantic reminders about what they
already know...
Also, changed code to cause "fixme" text to be inserted in output
in particular cases:
- if we can't manage to find any "source" metadata at all, we
now put fixme text into the output
- if we can't manage to find any "manual" metadata a all, we
now put fixme text into the output
The "source" and "manual" metadata is necessary information, so
buy putting the fixme stuff in the output, we alert users to the
need problem of it being missing.Michael(tm) Smith: refentry.xslWhen generating manpages output, we no longer report anything if
the refentry source is missing date or pubdate content. In
practice, many users intentionally omit the date from the source
because they explicitly want it to be generated.Michael(tm) Smith: l10n.xmlfurther change needed for switch from no locale to nb.Michael(tm) Smith: common.xslAdded support for orgname in authorgroup. Thanks to Camille
Bégnis.Michael(tm) Smith: Makefile"no" locale is now "nb"Mauritz Jeanson: stripns.xslRemoved the template matching "ng:link|db:link" (in order to make @xlink:show
work with <link> elements). As far as I can tell, this template is no longer needed.Mauritz Jeanson: entities.entMoved declaration of comment.block.parents entity to common/entities.ent.Mauritz Jeanson: titles.xslAdded an update the fix made in revision 7528 (handling of xref/link in no.anchor.mode mode).
Having xref in title is not a problem as long as the target is not an ancestor element.
Closes bug #1838136.
Note that an xref that is in a title and whose target is an ancestor element is still not
rendered in the TOC. This could be considered a bug, but on the other hand I cannot really
see the point in having such an xref in a document.Mauritz Jeanson: titles.xslAdded a "not(ancestor::title)" test to work around "too many nested
apply-templates" problems when processing xrefs or links in no.anchor.mode mode.
Hopefully, this closes bug #1811721.Mauritz Jeanson: titles.xslRemoved old template matching "link" in no.anchor.mode mode.Mauritz Jeanson: titles.xslProcess <link> in no.anchor.mode mode with the same template as <xref>.
Closes bug #1759205 (Empty link in no.anchor.mode mode).Mauritz Jeanson: titles.xslIn no.anchor.mode mode, do not output anchors for elements that are descendants
of <title>. Previously, having inline elements with @id/@xml:id in <title>s
resulted in anchors both in the TOC and in the main flow. Closes bug #1797492.FOThe following changes have been made to the
fo code
since the 1.73.2 release.Mauritz Jeanson: pi.xslUpdated documentation for keep-together.Mauritz Jeanson: task.xslEnabled use of the keep-together PI on task elements.Robert Stayton: index.xslFOP1 requires fo:wrapper for inline index entries, not fo:inline.Robert Stayton: index.xslFixed non-working inline.or.block template for indexterm wrappers.
Add fop1 to list of processors using inline.or.block.Mauritz Jeanson: table.xslFixed bug #1891965 (colsep in entytbl not working).Mauritz Jeanson: titlepage.xslAdded support for title in revhistory. Closes bug #1842847.Mauritz Jeanson: pi.xslSmall doc cleanup (dbfo float-type).Mauritz Jeanson: titlepage.xslInsert commas between multiple copyright holders.Mauritz Jeanson: autotoc.xsl; division.xslAdded modifications to support nested set elements. See bug #1853172.David Cramer: glossary.xslAdded normalize-space to xsl:sorts to avoid missorting of glossterms due to stray leading spaces.David Cramer: glossary.xslFixed bug #1854199: glossary.xsl should use the sortas attribute on glossentryMauritz Jeanson: inline.xslAdded a template for citebiblioid. The hyperlink target is the parent of the referenced biblioid,
and the "hot text" is the biblioid itself enclosed in brackets.Mauritz Jeanson: inline.xslMoved declaration of comment.block.parents entity to common/entities.ent.Mauritz Jeanson: docbook.xslUpdated message about unmatched element.Mauritz Jeanson: param.xwebAdded link to profiling chapter of TCG.Mauritz Jeanson: refentry.xslFixed typo (refsynopsysdiv -> refsynopsisdiv).David Cramer: fop.xsl; fop1.xsl; ptc.xsl; xep.xslAdded test to check generate.index param when generating pdf bookmarksMauritz Jeanson: graphics.xslAdded support for MathML in imagedata.Michael(tm) Smith: math.xslRemoved unnecessary extra test condition in test express that
checks for passivetex.Michael(tm) Smith: math.xslDon't use fo:instream-foreign-object if we are processing with
passivetex. Closes #1806899. Thanks to Justus Piater.Mauritz Jeanson: component.xslAdded code to output a TOC for an appendix in an article when
generate.toc='article/appendix toc'. Closes bug #1669658.Dongsheng Song: biblio-iso690.xslChange encoding from "windows-1250" to "UTF-8".Mauritz Jeanson: pi.xslUpdated documentation for dbfo_label-width.Mauritz Jeanson: lists.xslAdded support for the dbfo_label-width PI in calloutlists.Robert Stayton: biblio.xslSupport finding glossary database entries inside bibliodivs.Robert Stayton: formal.xslComplete support for <?dbfo pgwide="1"?> for informal
elements too.Mauritz Jeanson: table.xslIn the table.block template, added a check for the dbfo_keep-together PI, so that
a table may break (depending on the PI value) at a page break. This was needed
since the outer fo:block that surrounds fo:table has keep-together.within-column="always"
by default, which prevents the table from breaking. Closes bug #1740964 (Titled
table does not respect dbfo PI).Mauritz Jeanson: pi.xslAdded a few missing @role="tcg".Mauritz Jeanson: inline.xslUse normalize-space() in glossterm comparisons (as in html/inline.xsl).Mauritz Jeanson: autoidx.xslRemoved the [&scope;] predicate from the target variable in the template with name="reference".
This filter was the cause of missing index backlinks when @zone and @type were used on indexterms,
with index.on.type=1. Closes bug #1680836.Michael(tm) Smith: inline.xsl; xref.xsl; footnote.xslAdded capability in FO output for displaying URLs for all
hyperlinks (elements marked up with xlink:href attributes) in the
same way as URLs for ulinks are already handled (which is to say,
either inline or as numbered footnotes).
Background on this change:
DocBook 5 allows "ubiquitous" linking, which means you can make
any element a hyperlink just by adding an xlink:href attribute to
it, with the value set to an external URL. That's in contrast to
DocBook 4, which only allows you to use specific elements (e.g.,
the link and ulink elements) to mark up hyperlinks.
The existing FO stylesheets have a mechanism for handling display
of URLs for hyperlinks that are marked up with ulink, but they did
not handle display of URLs for elements that were marked up with
xlink:href attributes. This change adds handling for those other
elements, enabling the URLs they link to be displayed either
inline or as numbered footnotes (depending on what values the user
has the ulink.show and ulink.footnotes params set to).
Note that this change only adds URL display support for elements
that call the simple.xlink template -- which currently is most
(but not all) inline elements.
This change also moves the URL display handling out of the ulink
template and into a new "hyperlink.url.display" named template;
the ulink template and the simple.xlink named template now both
call the hyperlink.url.display template.
Warning: In the stylesheet code that determines what footnote
number to assign to each footnote or external hyperlink, there is
an XPath expression for determining whether a particular
xlink:href instance is an external hyperlink; that expression is
necessarily a bit complicated and further testing may reveal that
it doesn't handle all cases as expected -- so some refinements to
it may need to be done later.
Closes #1785519. Thanks to Ken Morse for reporting and
troubleshooting the problem.HTMLThe following changes have been made to the
html code
since the 1.73.2 release.Keith Fahlgren: inline.xsl; synop.xslWork to make HTML and XHTML targets more validKeith Fahlgren: table.xslAdd better handling for tables that have footnotes in the titlesKeith Fahlgren: biblio.xslAdd anchors to bibliodivsKeith Fahlgren: formal.xsl; Makefile; htmltbl.xslInitial checkin/merge of epub target from work provided by Paul Norton of Adobe
and Keith Fahlgren of O'Reilly.This change includes new code for generating the XHTML 1.1 target sanely.Mauritz Jeanson: biblio.xslAdded code for creating URLs from biblioids with @class="doi" (representing Digital
Object Identifiers). See FR #1934434 and http://doi.org.
To do: 1) Add support for FO output. 2) Figure out how @class="doi" should be handled
for bibliorelation, bibliosource and citebiblioid.Norman Walsh: formal.xslDon't use xsl:copy because it forces the resulting element to be in the same namespace as the source element; in the XHTML stylesheets, that's wrong. But the HTML-to-XHTML converter does the right thing with literal result elements, so use one of them.Michael(tm) Smith: MakefileAdded checks and hacks to various makefiles to enable building
under Cygwin. This stuff is ugly and maybe not worth the mess and
trouble, but does seem to work as expected and not break anything
else.Michael(tm) Smith: docbook.xsladded "exslt" namespace binding to html/docbook.xsl file (in
addition to existing "exsl" binding. reason is because lack of it
seems to cause processing problems when using the profiled
version of the stylsheetNorman Walsh: chunk-common.xslRename linkMauritz Jeanson: table.xslAdded a fix to make rowsep apply to the last row of thead in entrytbl.Michael(tm) Smith: synop.xslSimplified and streamlined handling of output for ANSI-style
funcprototype output, to correct a problem that was causing type
data to be lost in the output parameter definitions. For example,
for an instance like this:
<paramdef>void *<parameter>dataptr</parameter>[]</paramdef>
... the brackets (indicating an array type) were being dropped.Michael(tm) Smith: synop.xslChanged HTML handling of K&R-style paramdef output. The parameter
definitions are no longer output in a table (though the prototype
still is). The reason for the change is that the
kr-tabular-funcsynopsis-mode template was causing type data to be
lost in the output parameter definitions. For example, for an
instance like this:
<paramdef>void *<parameter>dataptr</parameter>[]</paramdef>
... the brackets (indicating an array type) were being dropped.
The easiest way to deal with the problem is to not try to chop up
the parameter definitions and display them in table format, but to
instead just output them as-is. May not look quite as pretty, but
at least we can be sure no information is being lost...Michael(tm) Smith: pi.xslupdated wording of doc for funcsynopsis-style PIMichael(tm) Smith: param.xweb; param.ent; synop.xslRemoved the funcsynopsis.tabular.threshold param. It's no longer
being used in the code and hasn't been since mid 2006.Mauritz Jeanson: graphics.xslAdded support for the img.src.path parameter for SVG graphics. Closes bug #1888169.Mauritz Jeanson: chunk-common.xslAdded missing space.Norman Walsh: component.xslFix bug where component titles inside info elements were not handled properlyMichael(tm) Smith: pi.xslMoved dbhtml_stop-chunking embedded doc into alphabetical order,
fixed text of TCG section it see-also'ed.David Cramer: pi.xslAdded support for <?dbhtml stop-chunking?> processing instructionDavid Cramer: chunk-common.xsl; pi.xslAdded support for <?dbhtml stop-chunking?> processing instructionDavid Cramer: glossary.xslFixed bug #1854199: glossary.xsl should use the sortas attribute on glossentry. Also added normalize-space to avoid missorting due to stray leading spaces.Mauritz Jeanson: inline.xslAdded a template for citebiblioid. The hyperlink target is the parent of the referenced biblioid,
and the "hot text" is the biblioid itself enclosed in brackets.Mauritz Jeanson: inline.xslAdded support for @xlink:show in the simple.xlink template. The "new" and "replace"
values are supported (corresponding to values of "_blank" and "_top" for the
ulink.target parameter). I have assumed that @xlink:show should override ulink.target
for external URI links. This closes bugs #1762023 and #1727498.Mauritz Jeanson: inline.xslMoved declaration of comment.block.parents entity to common/entities.ent.Mauritz Jeanson: param.xwebAdded link to profiling chapter of TCG.Dongsheng Song: biblio-iso690.xslChange encoding from "windows-1250" to "UTF-8".Robert Stayton: biblio.xslAdd support in biblio collection to entries in bibliodivs.Mauritz Jeanson: pi.xslAdded missing @role="tcg".Mauritz Jeanson: chunk-common.xsl; titlepage.xslRefactored legalnotice/revhistory chunking, so that the use.id.as.filename
parameter as well as the dbhtml_filename PI are taken into account. A new named
template in titlepage.xsl is used to compute the filename.Mauritz Jeanson: chunk-common.xsl; titlepage.xslAn update to the fix for bug #1790495 (r7433):
The "ln-" prefix is output only when the legalnotice doesn't have an
@id/@xml:id, in which case the stylesheets generate an ID value,
resulting in a filename like "ln-7e0fwgj.html". This is useful because
without the prefix, you wouldn't know that the file contained a legalnotice.
The same logic is also applied to revhistory, using an "rh-" prefix.Mauritz Jeanson: autoidx.xslRemoved the [&scope;] predicate from the target variable in the template with name="reference".
This filter was the cause of missing index backlinks when @zone and @type were used on indexterms,
with index.on.type=1. Closes bug #1680836.Mauritz Jeanson: titlepage.xslAdded 'ln-' prefix to the name of the legalnotice chunk, in order to match the
<link href"..."> that is output by make.legalnotice.head.links (chunk-common.xsl).
Modified the href attribute on the legalnotice link.
Closes bug #1790495.ManpagesThe following changes have been made to the
manpages code
since the 1.73.2 release.Michael(tm) Smith: other.xslslightly adjusted spacing around admonition markersMichael(tm) Smith: refentry.xsl; utility.xslmake sure refsect3 titles are preceded by a line of space, and
make the indenting of their child content less severeMichael(tm) Smith: block.xslonly indent verbatim environments in TTY output, not in non-TTY/PSMichael(tm) Smith: block.xslmade another adjustment to correct vertical alignment of admonition markerMichael(tm) Smith: block.xsl; other.xslAdjusted/corrected alignment of adominition marker in PS/non-TTY output.Michael(tm) Smith: endnotes.xslFor PS/non-TTY output, display footnote/endnote numbers in
superscript.Michael(tm) Smith: table.xsl; synop.xsl; utility.xslChanged handling of hanging indents for cmdsynopsis, funcsynopsis,
and synopfragment such that they now look correct in non-TTY/PS
output. We now use the groff \w escape to hang by the actual width
-- in the current font -- of the command, funcdef, or
synopfragment references number (as opposed to hanging by the
number of characters). This rendering in TTY output remains the
same, since the width in monospaced TTY output is the same as the
number of characters.
Also, created new synopsis-block-start and synopsis-block-end
templates to use for cmdsynopsis and funcsynopsis instead of the
corresponding verbatim-* templates.
Along with those changes, also corrected a problem that caused the
content of synopfragment to be dropped, and made a
vertical-spacing change to adjust spacing around table titles and
among sibling synopfragment instances.Michael(tm) Smith: other.xsluse common l10.language.name template to retrieve English-language nameMichael(tm) Smith: synop.xsl; inline.xsladded comment in code explaining why we don't put filename output
in italic (despite the fact that man guidelines say we should)Michael(tm) Smith: inline.xslput filename output in monospace instead of italicMichael(tm) Smith: synop.xslput cmdsynopsis in monospaceMichael(tm) Smith: inline.xslremoved template match for literal. template matches for monospace
inlines are all imported from the HTML stylesheetMichael(tm) Smith: block.xsldon't indent verbatim environments that are descendants of
refsynopsisdiv, not put backgrounds behind themMichael(tm) Smith: inline.xslset output of the literal element in monospace. this causes all
inline monospace instances in the git man pages to be set in
monospace (since DocBook XML source for git docs is generated with
asciidoc and asciidoc consistently outputs only <literal> for
inline monospace (not <command> or <code> or anything else).
Of course this only affects non-TTY output...Michael(tm) Smith: utility.xslAdded inline.monoseq named template.Michael(tm) Smith: utility.xsldon't bother using a custom register to store the previous
font-family value when setting blocks of text in code font; just
use \F[] .fam with no arg to switch backMichael(tm) Smith: endnotes.xslput links in blue in PS output (note that this matches how groff
renders content marked up with the .URL macro)Michael(tm) Smith: endnotes.xsl; param.xweb; param.entremoved man.links.are.underlined and added man.font.links. Also,
changed the default font formatting for links to bold.Michael(tm) Smith: endnotes.xsl; param.xweb; param.entAdded new param man.base.url.for.relative.links .. specifies a
base URL for relative links (for ulink, @xlink:href, imagedata,
audiodata, videodata) shown in the generated NOTES section of
man-page output. The value of man.base.url.for.relative.links is
prepended to any relative URI that is a value of ulink url,
xlink:href, or fileref attribute.
If you use relative URIs in link sources in your DocBook refentry
source, and you leave man.base.url.for.relative.links unset, the
relative links will appear "as is" in the NOTES section of any
man-page output generated from your source. That's probably not
what you want, because such relative links are only usable in the
context of HTML output. So, to make the links meaningful and
usable in the context of man-page output, set a value for
man.base.url.for.relative.links that points
to the online version of HTML output generated from your DocBook
refentry source. For example:
<xsl:param name="man.base.url.for.relative.links"
>http://www.kernel.org/pub/software/scm/git/docs/</xsl:param>Michael(tm) Smith: info.xslIf a source refentry contains a Documentation or DOCUMENTATION
section, don't report it as having missing AUTHOR information.
Also, if missing a contrib/personblurb for a person or org, report
pointers to http://docbook.sf.net/el/personblurb and to
http://docbook.sf.net/el/contribMichael(tm) Smith: info.xslIf we encounter an author|editor|othercredit instance that lacks a
personblurb or contrib, report it to the user (because that means
we have no information about that author|editor|othercredit to
display in the generated AUTHOR|AUTHORS section...)Michael(tm) Smith: info.xsl; docbook.xsl; other.xslif we can't find any usable author data, emit a warning and insert
a fixme in the outputMichael(tm) Smith: info.xslfixed bug in indenting of output for contrib instances in AUTHORS
section. Thanks to Daniel Leidert and the fglrx docs for exposing
the bug.Michael(tm) Smith: block.xslfor a para or simpara that is the first child of a callout,
suppress the .sp or .PP that would normally be output (because in
those cases, the output goes into a table cell, and the .sp or .PP
markup causes a spurious linebreak before it when displayedMichael(tm) Smith: lists.xslAdded support for rendering co callouts and calloutlist instances.
So you can now use simple callouts -- marking up programlisting
and such with co instances -- and have the callouts displayed in
man-page output. ("simple callouts" means using co@id and
callout@arearefs pointing to co@id instances; in man/roff output,
we can't/don't support markup that uses areaset and area)Michael(tm) Smith: block.xslonly put a line of space after a verbatim if it's followed by a
text node or a paragraphMichael(tm) Smith: utility.xslput verbatim environments in slightly smaller font in non-TTY
outputMichael(tm) Smith: lists.xslminor whitespace-only reformatting of lists.xsl sourceMichael(tm) Smith: lists.xslMade refinements/fixes to output of orderedlist and itemizedlist
-- in part, to get mysql man pages to display correctly. This
change causes a "\c" continuation marker to be added between
listitem markers and contents (to ensure that the content remains
on the same line as the marker when displayed)Michael(tm) Smith: block.xslput a line of vertical space after all verbatim output that has
sibling content following it (not just if that sibling content is
a text node)Michael(tm) Smith: block.xslrefined spacing around titles for admonitionsMichael(tm) Smith: block.xsl; other.xslDeal with case of verbatim environments that have a linebreak
after the opening tag. Assumption is that users generally don't
want that linebreak to appear in output, so we do some groff
hackery to mess with vertical spacing and close the space.Michael(tm) Smith: inline.xslindexterm instances now produce groff comments like this:
.\" primary: secondary: tertiary
remark instances, if non-empty, now produce groff commentsMichael(tm) Smith: charmap.groff.xsl; other.xslconvert no-break space character to groff "\ \&" (instead of just
"\ "). the reason is that if a space occurs at the end of a line,
our processing causes it to be eaten. a real-world case of this is
the mysql(1) man page. appending the "\&" prevents thatMichael(tm) Smith: block.xsloutput "sp" before simpara output, not after it (outputting it
after results in undesirable whitespace in particular cases; for
example, in the hg/mercurial docsMichael(tm) Smith: table.xsl; synop.xsl; utility.xslrenamed from title-preamble to pinch.together and replaced "sp -1"
between synopsis fragments with call to pinch.together insteadMichael(tm) Smith: table.xsluse title-preamble template for table titles (instead of "sp -1"
hack), and "sp 1" after all tables (instead of just "sp"Michael(tm) Smith: utility.xslcreated title-preamble template for suppressing line spacing after
headingsMichael(tm) Smith: info.xslfurther refinement of indenting in AUTHORS sectionMichael(tm) Smith: block.xsl; other.xslrefined handling of admonitionsMichael(tm) Smith: lists.xslUse RS/RE in another place where we had IP ""Michael(tm) Smith: info.xslReplace (ab)use of IP with "sp -1" in AUTHORS section with RS/RE
instead.Michael(tm) Smith: table.xsl; synop.xsl; info.xslchanged all instances of ".sp -1n" to ".sp -1"Michael(tm) Smith: other.xsladd extra line before SH heads only in non-TTY outputMichael(tm) Smith: block.xslReworked output for admonitions (caution, important, note, tip,
warning). In TTY output, admonitions now get indented. In non-TTY
output, a colored marker (yellow) is displayed next to them.Michael(tm) Smith: other.xslAdded BM/EM macros for putting a colored marker in margin next to
a block of text.Michael(tm) Smith: utility.xslcreated make.bold.title template by moving title-bolding part out
from nested-section-title template. This allows the bolding to
also be used by the template for formatting admonitionsMichael(tm) Smith: info.xslput .br before copyright contents to prevent them from getting run inMichael(tm) Smith: refentry.xsl; other.xsl; utility.xslmade point size of output for Refsect2 and Refsect3 heads biggerMichael(tm) Smith: other.xslput slightly more space between SH head and underline in non-TTY
outputMichael(tm) Smith: param.xweb; param.ent; other.xslAdded the man.charmap.subset.profile.english parameter and refined
the handling of charmap subsets to differentiate between English
and non-English source.
This way charmap subsets are now handled is this:
If the value of the man.charmap.use.subset parameter is non-zero,
and your DocBook source is not written in English (that is, if its
lang or xml:lang attribute has a value other than en), then the
character-map subset specified by the man.charmap.subset.profile
parameter is used instead of the full roff character map.
Otherwise, if the lang or xml:lang attribute on the root element
in your DocBook source or on the first refentry element in your
source has the value en or if it has no lang or xml:lang
attribute, then the character-map subset specified by the
man.charmap.subset.profile.english parameter is used instead of
man.charmap.subset.profile.
The difference between the two subsets is that
man.charmap.subset.profile provides mappings for characters in
Western European languages that are not part of the Roman
(English) alphabet (ASCII character set).Michael(tm) Smith: other.xslVarious updates, mainly related to uppercasing SH titles:
- added a "Language: " metadata line to the top comment area of
output man pages, to indicate the language the page is in
- added a "toupper" macro of doing locale-aware uppercasing of
SH titles and cross-references to SH titles; the mechanism
relies on the uppercase.alpha and lowercase.alpha DocBook
gentext keys to do locale-aware uppercasing based on the
language the page is written in
- added a "string.shuffle" template, which provides a library
function for "shuffling" two strings together into a single
string; it takes the first character for the first string, the
first character from second string, etc. The only current use
for it is to generate the argument for the groff tr request
that does string uppercasing.
- added make.tr.uppercase.arg and make.tr.normalcase.arg named
templates for use in generating groff code for uppercasing and
"normal"-casing SH titles
- made the BB/BE "background drawing" macros have effect only in
non-TTY output
- output a few comments in the top part of sourceMichael(tm) Smith: utility.xslremoved some leftover kruftMichael(tm) Smith: refentry.xslTo create the name(s) for each man page, we now replace any spaces
in the refname(s) with underscores. This ensures that tools like
lexgrog(1) will be able to parse the name (lexgrog won't parse
names that contain spaces).Michael(tm) Smith: docbook.xslPut a comment into source of man page to indicate where the main
content starts. (We now have a few of macro definitions at the
start of the source, so putting this comment in helps those that
might be viewing the source.)Michael(tm) Smith: refentry.xslrefined mechanism for generating SH titlesMichael(tm) Smith: charmap.groff.xslAdded zcaron, Zcaron, scaron, and Scaron to the groff character map.
This means that generated Finnish man pages will no longer contain
any raw accented characters -- they'll instead by marked up with
groff escapes.Michael(tm) Smith: other.xsl; utility.xslcorrected a regression I introduced about a year ago that caused
dots to be output just as "\." -- instead needs to be "\&." (which
is what it will be now, after this change)Michael(tm) Smith: refentry.xslChanged backend handling for generating titles for SH sections and
for cross-references to those sections. This should have no effect
on TTY output (behavior should remain the same hopefully) but
results in titles in normal case (instead of uppercase) in PS
output.Michael(tm) Smith: info.xsluse make.subheading template to make subheadings for AUTHORS and
COPYRIGHT sections (instead of harcoding roff markup)Michael(tm) Smith: block.xslput code font around programlisting etc.Michael(tm) Smith: synop.xsl; docbook.xslembed custom macro definitions in man pages, plus wrap synopsis in
code fontMichael(tm) Smith: endnotes.xsluse the make.subheading template to generated SH subheading for
endnotes section.Michael(tm) Smith: lists.xslAdded some templates for generating if-then-else conditional
markup in groff, so let's use those instead of hard-coding it in
multiple places...Michael(tm) Smith: other.xsl; utility.xslInitial checkin of some changes related to making PS/PDF output
from "man -l -Tps" look better. The current changes:
- render synopsis and verbatim sections in a monospace/code font
- put a light-grey background behind all programlisting, screen,
and literallayout instances
- prevent SH heads in PS output from being rendered in uppercase
(as they are in console output)
- also display xrefs to SH heads in PS output in normal case
(instead of uppercase)
- draw a line under SH heads in PS output
The changes made to the code to support the above features were:
- added some embedded/custom macros: one for conditionally
upper-casing SH x-refs, one for redefining the SH macro
itself, with some conditional handling for PS output, and
finally a macro for putting a background/screen (filled box)
around a block of text (e.g., a program listing) in PS output
- added utility templates for wrapping blocks of text in code
font; also templates for inline code fontRobert Stayton: refentry.xslrefpurpose nodes now get apply-templates instead of just normalize-space().Michael(tm) Smith: lists.xslFixed alignment of first lined of text for each listitem in
orderedlist output for TTY. Existing code seemed to have been
causing an extra undesirable space to appear.Michael(tm) Smith: lists.xslWrapped some roff conditionals around roff markup for orderedlist
and itemizedlist output, so that the lists look acceptable in PS
output as well as TTY.Michael(tm) Smith: pi.xsl; synop.xsl; param.xweb; param.entAdded the man.funcsynopsis.style parameter. Has the same effect in
manpages output as the funcsynopsis.style parameter has in HTML
output -- except that its default value is 'ansi' instead of 'kr'.Michael(tm) Smith: synop.xslReworked handling of K&R funcprototype output. It no longer relies
on the HTML kr-tabular templates, but instead just does direct
transformation to roff. For K&R output, it displays the paramdef
output in an indented list following the prototype.Michael(tm) Smith: synop.xslProperly integrated handling for K&R output into manpages
stylesheet. The choice between K&R output and ANSI output is
currently controlled through use of the (HTML) funcsynopsis.style
parameter. Note that because the mechanism does currently rely on
funcsynopsis.style, the default in manpages output is now K&R
(because that's the default of that param). But I suppose I ought
to create a man.funcsynopsis.style and make the default for that
ANSI (to preserve the existing default behavior).Michael(tm) Smith: docbook.xsladded manpages/pi.xsl fileMichael(tm) Smith: .cvsignore; pi.xslAdded "dbman funcsynopsis-style" PI and incorporated it into the
doc build.Michael(tm) Smith: refentry.xslFixed regression that caused an unescaped dash to be output
between refname and refpurpose content. Closes bug #1894244.
Thanks to Daniel Leidert.Michael(tm) Smith: other.xslFixed problem with dots being escaped in filenames of generated
man files. Closes #1827195. Thanks to Daniel Leidert.Michael(tm) Smith: inline.xslAdded support for processing structfield (was appearing in roff
output surrounded by HTML <em> tags; fixed so that it gets roff
ital markup). Closes bug #1858329. Thanks to Sam Varshavchik.EpubThe following changes have been made to the
epub code
since the 1.73.2 release.Keith Fahlgren: bin/spec/README; bin/spec/epub_realbook_spec.rb'Realbook' spec now passesKeith Fahlgren: bin/dbtoepub; README; bin/spec/README; bin/lib/docbook.rb; bin/spec/epub_r⋯Very primitive Windows support for dbtoepub reference implementation; README for running tests and for the .epub target in general; shorter realbook test document (still fails for now)Keith Fahlgren: bin/dbtoepub; bin/spec/epub_regressions_spec.rb; bin/lib/docbook.rb; bin/s⋯Changes to OPF spine to not duplicate idrefs for documents with parts not at the root; regression specs for sameKeith Fahlgren: docbook.xslFixing linking to cover @id, distinct from other needs of cover-image-id (again, thanks to Martin Goerner)Keith Fahlgren: docbook.xslUpdating the title of the toc element in the guide to be more explicit (thanks to Martin Goerner)Keith Fahlgren: bin/spec/examples/amasque_exploded/content.opf; bin/spec/examples/amasque_⋯Initial checkin/merge of epub target from work provided by Paul Norton of Adobe
and Keith Fahlgren of O'Reilly.Keith Fahlgren: docbook.xsl== General epub test support
$ spec -O ~/.spec.opts spec/epub_spec.rb
DocBook::Epub
- should be able to be created
- should fail on a nonexistent file
- should be able to render to a file
- should create a file after rendering
- should have the correct mimetype after rendering
- should be valid .epub after rendering an article
- should be valid .epub after rendering an article without sections
- should be valid .epub after rendering a book
- should be valid .epub after rendering a book even if it has one graphic
- should be valid .epub after rendering a book even if it has many graphics
- should be valid .epub after rendering a book even if it has many duplicated graphics
- should report an empty file as invalid
- should confirm that a valid .epub file is valid
- should not include PDFs in rendered epub files as valid image inclusions
- should include a TOC link in rendered epub files for <book>s
Finished in 20.608395 seconds
15 examples, 0 failures
== Verbose epub test coverage against _all_ of the testdocs
Fails on only (errors truncated):
1)
'DocBook::Epub should be able to render a valid .epub for the test document /Users/keith/work/docbook-dev/trunk/xsl/epub/bin/spec/testdocs/calloutlist.003.xml [30]' FAILED
'DocBook::Epub should be able to render a valid .epub for the test document /Users/keith/work/docbook-dev/trunk/xsl/epub/bin/spec/testdocs/cmdsynopsis.001.xml [35]' FAILED
....
Finished in 629.89194 seconds
224 examples, 15 failures
224 examples, 15 failures yields 6% failure rateHTMLHelpThe following changes have been made to the
htmlhelp code
since the 1.73.2 release.Mauritz Jeanson: htmlhelp-common.xslAdded <xsl:with-param name="quiet" select="$chunk.quietly"/> to calls to
the write.chunk, write.chunk.with.doctype, and write.text.chunk templates.
This makes chunk.quietly=1 suppress chunk filename messages also for help
support files (which seems to be what one would expect). See bug #1648360.EclipseThe following changes have been made to the
eclipse code
since the 1.73.2 release.David Cramer: eclipse.xslUse sortas attributes (if they exist) when sorting indextermsDavid Cramer: eclipse.xslAdded support for indexterm/see in eclipse index.xmlMauritz Jeanson: eclipse.xslAdded <xsl:with-param name="quiet" select="$chunk.quietly"/>
to helpidx template.David Cramer: eclipse.xslGenerate index.xml file and add related goo to plugin.xml file. Does not yet support see and seealso.Mauritz Jeanson: eclipse.xslAdded <xsl:with-param name="quiet" select="$chunk.quietly"/> to calls to
the write.chunk, write.chunk.with.doctype, and write.text.chunk templates.
This makes chunk.quietly=1 suppress chunk filename messages also for help
support files (which seems to be what one would expect). See bug #1648360.JavaHelpThe following changes have been made to the
javahelp code
since the 1.73.2 release.Mauritz Jeanson: javahelp.xslAdded <xsl:with-param name="quiet" select="$chunk.quietly"/> to calls to
the write.chunk, write.chunk.with.doctype, and write.text.chunk templates.
This makes chunk.quietly=1 suppress chunk filename messages also for help
support files (which seems to be what one would expect). See bug #1648360.RoundtripThe following changes have been made to the
roundtrip code
since the 1.73.2 release.Steve Ball: blocks2dbk.xsl; wordml2normalise.xslfix table/cell borders for wordml, fix formal figure, add emphasis-strongMauritz Jeanson: supported.xmlChanged @cols to 5.Steve Ball: blocks2dbk.xsl; blocks2dbk.dtd; template.xmladded pubdate, fixed metadata handling in biblioentrySteve Ball: supported.xmlAdded support for edition.Steve Ball: docbook-pages.xsl; wordml-blocks.xsl; docbook.xsl; wordml.xsl; pages-normalise⋯Removed stylesheets for old, deprecated conversion method.Steve Ball: specifications.xml; dbk2ooo.xsl; blocks2dbk.xsl; dbk2pages.xsl; blocks2dbk.dtd⋯Added support for Open Office, added edition element, improved list and table support in Word and PagesSteve Ball: normalise-common.xsl; blocks2dbk.xsl; dbk2pages.xsl; template-pages.xml; templ⋯Fixed bug in WordML table handling, improved table handling for Pages 08, synchronised WordML and Pages templates.Steve Ball: normalise-common.xsl; blocks2dbk.xsl; wordml2normalise.xsl; dbk2wp.xslfix caption, attributesSteve Ball: specifications.xml; blocks2dbk.xsl; wordml2normalise.xsl; blocks2dbk.dtd; temp⋯Fixes to table and list handlingSteve Ball: blocks2dbk.xsladded support for explicit emphasis character stylesSteve Ball: wordml2normalise.xsladded support for customisation in image handlingSteve Ball: blocks2dbk.xslAdded inlinemediaobject support for metadata.Steve Ball: normalise-common.xsl; blocks2dbk.xsl; template.xml; dbk2wordml.xsl; dbk2wp.xslAdded support file. Added style locking. Conversion bug fixes.SlidesThe following changes have been made to the
slides code
since the 1.73.2 release.Michael(tm) Smith: fo/Makefile; html/MakefileAdded checks and hacks to various makefiles to enable building
under Cygwin. This stuff is ugly and maybe not worth the mess and
trouble, but does seem to work as expected and not break anything
else.Jirka Kosek: html/plain.xslAdded support for showing foil numberWebsiteThe following changes have been made to the
website code
since the 1.73.2 release.Michael(tm) Smith: extensions/saxon64/.classes/.gitignore; extensions/xalan2/.classes/com/⋯renamed a bunch more .cvsignore files to .gitignore (to facilitate use of git-svn)ParamsThe following changes have been made to the
params code
since the 1.73.2 release.Keith Fahlgren: epub.autolabel.xmlNew parameter for epub, epub.autolabelMauritz Jeanson: table.frame.border.color.xml; table.cell.padding.xml; table.cell.border.t⋯Added missing refpurposes and descriptions.Keith Fahlgren: ade.extensions.xmlExtensions to support Adobe Digital Editions extensions in .epub output.Mauritz Jeanson: fop.extensions.xml; fop1.extensions.xmlClarified that fop1.extensions is for FOP 0.90 and later. Version 1 is not here yet...Michael(tm) Smith: man.links.are.underlined.xml; man.endnotes.list.enabled.xml; man.font.l⋯removed man.links.are.underlined and added man.font.links. Also,
changed the default font formatting for links to bold.Michael(tm) Smith: man.base.url.for.relative.links.xmlAdded new param man.base.url.for.relative.links .. specifies a
base URL for relative links (for ulink, @xlink:href, imagedata,
audiodata, videodata) shown in the generated NOTES section of
man-page output. The value of man.base.url.for.relative.links is
prepended to any relative URI that is a value of ulink url,
xlink:href, or fileref attribute.
If you use relative URIs in link sources in your DocBook refentry
source, and you leave man.base.url.for.relative.links unset, the
relative links will appear "as is" in the NOTES section of any
man-page output generated from your source. That's probably not
what you want, because such relative links are only usable in the
context of HTML output. So, to make the links meaningful and
usable in the context of man-page output, set a value for
man.base.url.for.relative.links that points
to the online version of HTML output generated from your DocBook
refentry source. For example:
<xsl:param name="man.base.url.for.relative.links"
>http://www.kernel.org/pub/software/scm/git/docs/</xsl:param>Michael(tm) Smith: man.string.subst.map.xmlsqueeze .sp\n.sp into a single .sp (to prevent a extra, spurious
line of whitespace from being inserted after programlisting etc.
in certain cases)Michael(tm) Smith: refentry.manual.fallback.profile.xml; refentry.source.fallback.profile.⋯don't use refmiscinfo@class=date value as fallback for refentry
"source" or "manual" metadata fieldsMichael(tm) Smith: man.charmap.subset.profile.xml; man.charmap.enabled.xml; man.charmap.su⋯made some further doc tweaks related to the
man.charmap.subset.profile.english paramMichael(tm) Smith: man.charmap.subset.profile.xml; man.charmap.enabled.xml; man.charmap.su⋯Added the man.charmap.subset.profile.english parameter and refined
the handling of charmap subsets to differentiate between English
and non-English source.
This way charmap subsets are now handled is this:
If the value of the man.charmap.use.subset parameter is non-zero,
and your DocBook source is not written in English (that is, if its
lang or xml:lang attribute has a value other than en), then the
character-map subset specified by the man.charmap.subset.profile
parameter is used instead of the full roff character map.
Otherwise, if the lang or xml:lang attribute on the root element
in your DocBook source or on the first refentry element in your
source has the value en or if it has no lang or xml:lang
attribute, then the character-map subset specified by the
man.charmap.subset.profile.english parameter is used instead of
man.charmap.subset.profile.
The difference between the two subsets is that
man.charmap.subset.profile provides mappings for characters in
Western European languages that are not part of the Roman
(English) alphabet (ASCII character set).Michael(tm) Smith: man.charmap.subset.profile.xmlAdded to default charmap used by manpages:
- the "letters" part of the 'C1 Controls And Latin-1 Supplement
(Latin-1 Supplement)' Unicode block
- Latin Extended-A block (but not all of the characters from
that block have mappings in groff, so some of them are still
passed through as-is)
The effects of this change are that in man pages generated for
most Western European languages and for Finnish, all characters
not part of the Roman alphabet are (e.g., "accented" characters)
are converted to groff escapes.
Previously, by default we passed through those characters as is
(and users needed to use the full charmap if they wanted to have
those characters converted).
As a result of this change, man pages generated for Western
European languages will be viewable in some environments in which
they are not viewable if the "raw" non-Roman characters are in them.Mauritz Jeanson: generate.legalnotice.link.xml; generate.revhistory.link.xmlAdded information on how the filename is computed.Mauritz Jeanson: default.table.width.xmlClarified PI usage.Michael(tm) Smith: man.funcsynopsis.style.xmlAdded the man.funcsynopsis.style parameter. Has the same effect in
manpages output as the funcsynopsis.style parameter has in HTML
output -- except that its default value is 'ansi' instead of 'kr'.Michael(tm) Smith: funcsynopsis.tabular.threshold.xmlRemoved the funcsynopsis.tabular.threshold param. It's no longer
being used in the code and hasn't been since mid 2006.Mauritz Jeanson: table.properties.xmlSet keep-together.within-column to "auto". This seems to be the most sensible
default value for tables.Mauritz Jeanson: informal.object.properties.xml; admon.graphics.extension.xml; informalequ⋯Several small documentation fixes.Mauritz Jeanson: manifest.in.base.dir.xmlWording fixes.Mauritz Jeanson: header.content.properties.xml; footer.content.properties.xmlAdded refpurpose.Mauritz Jeanson: ulink.footnotes.xml; ulink.show.xmlUpdated for DocBook 5.Mauritz Jeanson: index.method.xml; glossterm.auto.link.xmlSpelling and wording fixes.Mauritz Jeanson: callout.graphics.extension.xmlClarifed available graphics formats and extensions.Mauritz Jeanson: footnote.sep.leader.properties.xmlCorrected refpurpose.Jirka Kosek: footnote.properties.xmlAdded more properties which make it possible to render correctly footnotes placed inside verbatim elements.Mauritz Jeanson: img.src.path.xmlimg.src.path works with inlinegraphic too.Mauritz Jeanson: saxon.character.representation.xmlAdded TCG link.Mauritz Jeanson: img.src.path.xmlUpdated description of img.src.path. Bug #1785224 revealed that
there was a risk of misunderstanding how it works.ProfilingThe following changes have been made to the
profiling code
since the 1.73.2 release.Jirka Kosek: xsl2profile.xslAdded new rules to profile all content generated by HTML Help (including alias files)Robert Stayton: profile-mode.xsluse mode="profile" instead of xsl:copy-of for attributes so
they can be more easily customized.ToolsThe following changes have been made to the
tools code
since the 1.73.2 release.Michael(tm) Smith: make/Makefile.DocBookvarious changes and additions to support making with asciidoc as
an input formatMichael(tm) Smith: make/Makefile.DocBookmake dblatex the default PDF maker for the example makefileMichael(tm) Smith: xsl/build/html2roff.xslReworked handling of K&R funcprototype output. It no longer relies
on the HTML kr-tabular templates, but instead just does direct
transformation to roff. For K&R output, it displays the paramdef
output in an indented list following the prototype.Mauritz Jeanson: xsl/build/make-xsl-params.xslMade attribute-sets members of the param list. This enables links to attribute-sets in the
reference documentation.Michael(tm) Smith: xsl/build/html2roff.xsluse .BI handling in K&R funsynopsis output for manpages, just as
we do already of ANSI outputMichael(tm) Smith: xsl/build/html2roff.xslImplemented initial support for handling tabular K&R output of
funcprototype in manpages output. Accomplished by adding more
templates to the intermediate HTML-to-roff stylesheet that the
build uses to create the manpages/html-synop.xsl stylesheet.Michael(tm) Smith: xsl/build/doc-link-docbook.xslMade the xsl/tools/xsl/build/doc-link-docbook.xsl stylesheet
import profile-docbook.xsl, so that we can do profiling of release
notes. Corrected some problems in the target for the release-notes
HTML build.ExtensionsThe following changes have been made to the
extensions code
since the 1.73.2 release.Keith Fahlgren: MakefileUse DOCBOOK_SVN variable everywhere, please; build with PDF_MAKERMichael(tm) Smith: Makefilemoved extensions build targets from master xsl/Makefile to
xsl/extensions/MakefileMichael(tm) Smith: .cvsignorere-adding empty extensions subdirXSL-SaxonThe following changes have been made to the
xsl-saxon code
since the 1.73.2 release.Michael(tm) Smith: VERSIONbring xsl2, xsl-saxon, and xsl-xalan VERSION files up-to-date with
recent change to snapshot build infrastructureMichael(tm) Smith: nbproject/build-impl.xml; nbproject/project.propertiesChanged hard-coded file references in "clean" target to variable
references. Closes #1792043. Thanks to Daniel Leidert.Michael(tm) Smith: VERSION; MakefileDid post-release wrap-up of xsl-saxon and xsl-xalan dirsMichael(tm) Smith: nbproject/build-impl.xml; VERSION; Makefile; testMore tweaks to get release-readyXSL-XalanThe following changes have been made to the
xsl-xalan code
since the 1.73.2 release.Michael(tm) Smith: VERSIONbring xsl2, xsl-saxon, and xsl-xalan VERSION files up-to-date with
recent change to snapshot build infrastructureMichael(tm) Smith: nbproject/build-impl.xmlChanged hard-coded file references in "clean" target to variable
references. Closes #1792043. Thanks to Daniel Leidert.Michael(tm) Smith: Makefile; VERSIONDid post-release wrap-up of xsl-saxon and xsl-xalan dirsMichael(tm) Smith: Makefile; nbproject/build-impl.xml; VERSIONMore tweaks to get release-readyXSL-libxsltThe following changes have been made to the
xsl-libxslt code
since the 1.73.2 release.Mauritz Jeanson: python/xslt.pyPrint the result to stdout if no outfile has been given.
Some unnecessary semicolons removed.Mauritz Jeanson: python/xslt.pyAdded a function that quotes parameter values (to ensure that they are interpreted as strings).
Replaced deprecated functions from the string module with string methods.Michael(tm) Smith: python/README; python/README.LIBXSLTrenamed xsl-libxslt/python/README to xsl-libxslt/python/README.LIBXSLTMauritz Jeanson: python/READMETweaked the text a little.Release Notes: 1.73.2This is solely a minor bug-fix update to the 1.73.1 release.
It fixes a packaging error in the 1.73.1 package, as well as a
bug in footnote handling in FO output.Release: 1.73.1This is mostly a bug-fix update to the 1.73.0 release.GentextThe following changes have been made to the
gentext code
since the 1.73.0 release.Mauritz Jeanson: locale/de.xmlApplied patch #1766009.Michael(tm) Smith: locale/lv.xmlAdded localization for ProductionSet.FOThe following changes have been made to the
fo code
since the 1.73.0 release.Mauritz Jeanson: table.xslModified the tgroup template so that, for tables with multiple tgroups,
a width attribute is output on all corresponding fo:tables. Previously,
there was a test prohibiting this (and a comment saying that outputting more
than one width attribute will cause an error). But this seems to be no longer
relevant; it is not a problem with FOP 0.93 or XEP 4.10. Closes bug #1760559.Mauritz Jeanson: graphics.xslReplaced useless <a> elements with warning messages (textinsert extension).Mauritz Jeanson: admon.xslEnabled generation of ids (on fo:wrapper) for indexterms in admonition titles, so that page
references in the index can be created. Closes bug #1775086.HTMLThe following changes have been made to the
html code
since the 1.73.0 release.Mauritz Jeanson: titlepage.xslAdded <xsl:call-template name="process.footnotes"/> to abstract template
so that footnotes in info/abstract are processed. Closes bug #1760907.Michael(tm) Smith: pi.xsl; synop.xslChanged handling of HTML output for the cmdsynopsis and
funcsynopsis elements, such that a@id instances are generated for
them if they are descendants of any element containing a dbcmdlist
or dbfunclist PI. Also, update the embedded reference docs for the
dbcmdlist and dbfunclist PIs to make it clear that they can be
used within any element for which cmdsynopsis or funcsynopsis are
valid children.Michael(tm) Smith: formal.xslReverted the part of revision 6952 that caused a@id anchors to be
generated for output of informal objects. Thanks to Sam Steingold
for reporting.Robert Stayton: glossary.xslAccount for a glossary with no glossdiv or glossentry children.Mauritz Jeanson: titlepage.xslModified legalnotice template so that the base.name parameter is calculated
in the same way as for revhistory chunks. Using <xsl:apply-templates
mode="chunk-filename" select="."/> did not work for single-page output since
the template with that mode is in chunk-code.xsl.Mauritz Jeanson: graphics.xslUpdated support for SVG (must be a child of imagedata in DB 5).
Added support for MathML in imagedata.Mauritz Jeanson: pi.xslAdded documentation for the dbhh PI (used for context-sensitive HTML Help).
(The two templates matching 'dbhh' are still in htmlhelp-common.xsl).ManpagesThe following changes have been made to the
manpages code
since the 1.73.0 release.Michael(tm) Smith: endnotes.xslIn manpages output, generate warnings about notesources with
non-para children only if the notesource is a footnote or
annotation. Thanks to Sam Steingold for reporting problems with
the existing handling.HTMLHelpThe following changes have been made to the
htmlhelp code
since the 1.73.0 release.Michael(tm) Smith: htmlhelp-common.xslAdded single-pass namespace-stripping support to the htmlhelp,
eclipse, and javahelp stylesheets.EclipseThe following changes have been made to the
eclipse code
since the 1.73.0 release.Michael(tm) Smith: eclipse.xslAdded single-pass namespace-stripping support to the htmlhelp,
eclipse, and javahelp stylesheets.JavaHelpThe following changes have been made to the
javahelp code
since the 1.73.0 release.Michael(tm) Smith: javahelp.xslAdded single-pass namespace-stripping support to the htmlhelp,
eclipse, and javahelp stylesheets.RoundtripThe following changes have been made to the
roundtrip code
since the 1.73.0 release.Steve Ball: blocks2dbk.xsl; blocks2dbk.dtd; pages2normalise.xslModularised blocks2dbk to allow customisation,
Added support for tables to pages2normaliseParamsThe following changes have been made to the
params code
since the 1.73.0 release.Robert Stayton: procedure.properties.xmlprocedure was inheriting keep-together from formal.object.properties, but
a procedure does not need to be kept together by default.Dave Pawson: title.font.family.xml; component.label.includes.part.label.xml; table.frame.b⋯Regular formatting re-org.Release: 1.73.0This release includes important bug fixes and adds the following
significant feature changes:
New localizations and localization updatesWe added two new localizations: Latvian and
Esperanto, and made updates to the Czech, Chinese
Simplified, Mongolian, Serbian, Italian, and Ukrainian
localizations.ISO690 citation style for bibliography output.Set the
bibliography.style parameter to
iso690 to use ISO690 style.New documentation for processing instructions (PI)The reference documentation that ships with the
release now includes documentation on all PIs that you can use to
control output from the stylesheets.New profiling parameters for audience and wordsizeYou can now do profiling based on the values of the
audience and
wordsize attributes.Changes to man-page outputThe manpages stylesheet now supports single-pass
profiling and single-pass DocBook 5 namespace stripping
(just as the HTML and FO stylesheets also do). Also, added
handling for mediaobject &
inlinemediaobject. (Each imagedata,
audiodata, or videodata element
within a mediaobject or inline
mediaobject is now treated as a "notesource"
and so handled in much the same way as links and
annotation/alt/footnote
are in manpages output.) And added the
man.authors.section.enabled and
man.copyright.section.enabled
parameters to enable control over whether output includes
auto-generated AUTHORS and
COPYRIGHT sections.Highlighting support for CThe highlighting mechanism for generating
syntax-highlighted code snippets in output now supports C
code listings (along with Java, PHP, XSLT, and others).Experimental docbook-xsl-update scriptWe added an experimental docbook-xsl-update
script, the purpose of which is to facilitate
easy sync-up to the latest docbook-xsl snapshot (by means
of rsync).GentextThe following changes have been made to the
gentext code
since the 1.72.0 release.Michael(tm) Smith: locale/lv.xml; MakefileAdded Latvian localization file, from Girts Ziemelis.Dongsheng Song: locale/zh_cn.xmlBrought up to date with en.xml in terms of items. A few strings marked for translation.Jirka Kosek: locale/cs.xmlAdded missing translationsRobert Stayton: locale/eo.xmlNew locale for Esperanto.Robert Stayton: locale/mn.xmlUpdate from Ganbold Tsagaankhuu.Jirka Kosek: locale/en.xml; locale/cs.xmlRules for normalizing glossary entries before they are sorted can be now different for each language.Michael(tm) Smith: locale/sr_Latn.xml; locale/sr.xmlCommitted changes from Miloš Komarčević to Serbian files.Robert Stayton: locale/ja.xmlFix chapter in context xref-number-and-titleRobert Stayton: locale/it.xmlImproved version from contributor.Mauritz Jeanson: locale/uk.xmlApplied patch 1592083.CommonThe following changes have been made to the
common code
since the 1.72.0 release.Michael(tm) Smith: labels.xslChanged handling of reference auto-labeling such that reference
(when it appears at the component level) is now affected by the
label.from.part param, just as preface, chapter, and appendix.Michael(tm) Smith: common.xslAdded support to the HTML stylesheets for proper processing of
orgname as a child of author.Michael(tm) Smith: refentry.xslRefined logging output of refentry metadata-gathering template;
for some cases of "missing" elements (refmiscinfo stuff, etc.),
the log messages now include URL to corresponding page in the
Definitive Guide (TDG).Robert Stayton: titles.xslAdd refsection/info/title support.Michael(tm) Smith: titles.xslAdded support for correct handling of xref to elements that
contain info/title descendants but no title children.
This should be further refined so that it handles any *info
elements. And there are probably some other places where similar
handling for *info/title should be added.Mauritz Jeanson: pi.xslModified <xsl:when> in datetime.format template to work
around Xalan bug.FOThe following changes have been made to the
fo code
since the 1.72.0 release.Robert Stayton: component.xslAdd parameters to the page.sequence utility template.Mauritz Jeanson: xref.xslAdded template for xref to area/areaset.
Part of fix for bug #1675513 (xref to area broken).Michael(tm) Smith: inline.xslAdded template match for person element to fo stylesheet.Robert Stayton: lists.xslAdded support for spacing="compact" in variablelist, per bug report #1722540.Robert Stayton: table.xsltable pgwide="1" should also use pgwide.properties attribute-set.Mauritz Jeanson: inline.xslMake citations numbered if bibliography.numbered != 0.Robert Stayton: param.xweb; param.entAdd new profiling parameters for audience and wordsize.Robert Stayton: param.xweb; param.entAdded callout.icon.size parameter.Robert Stayton: inline.xsl; xref.xslAdd support for xlink as olink.Robert Stayton: autotoc.xsl; param.xweb; param.entAdd support for qanda.in.toc to fo TOC.Robert Stayton: component.xslImproved the page.sequence utility template for use with book.Robert Stayton: division.xslRefactored the big book template into smaller pieces.
Used the "page.sequence" utility template in
component.xsl to shorten the toc piece.
Added placeholder templates for front.cover and back.cover.Robert Stayton: param.xweb; param.ent; sections.xslAdd section.container.element parameter to enable
pgwide spans inside sections.Robert Stayton: param.xweb; param.ent; component.xslAdd component.titlepage.properties attribute-set to
support span="all" and other properties.Robert Stayton: htmltbl.xsl; table.xslApply table.row.properties template to html tr rows too.
Add keep-with-next to table.row.properties when row is in thead.Robert Stayton: table.xslAdd support for default.table.frame parameter.
Fix bug 1575446 rowsep last check for @morerows.Robert Stayton: refentry.xslAdd support for info/title in refsections.David Cramer: qandaset.xslMake fo questions and answers behave the same way as htmlJirka Kosek: lists.xslAdded missing attribute set for procedureJirka Kosek: param.xweb; biblio.xsl; docbook.xsl; param.ent; biblio-iso690.xslAdded support for formatting biblioentries according to ISO690 citation style.
New bibliography style can be turned on by setting parameter bibliography.style to "iso690"
The code was provided by Jana DvorakovaRobert Stayton: param.xweb; param.ent; pagesetup.xslAdd header.table.properties and footer.table.properties attribute-sets.Robert Stayton: inline.xslAdd fop1.extensions for menuchoice arrow handling exception.HTMLThe following changes have been made to the
html code
since the 1.72.0 release.Mauritz Jeanson: param.xweb; param.entMoved declaration and documentation of javahelp.encoding from javahelp.xsl to the
regular "parameter machinery".Michael(tm) Smith: admon.xslChanged handling of titles for note, warning, caution, important,
tip admonitions: We now output and HTML h3 head only if
admon.textlabel is non-zero or if the admonition actually contains
a title; otherwise, we don't output an h3 head at all.
(Previously, we were outputting an empty h3 if the admon.textlabel
was zero and if the admonition had no title.)Mauritz Jeanson: xref.xslAdded template for xref to area/areaset.
Part of fix for bug #1675513 (xref to area broken).Mauritz Jeanson: titlepage.xsl; component.xsl; division.xsl; sections.xslAdded fixes to avoid duplicate ids when generate.id.attributes = 1.
This (hopefully) closes bug #1671052.Michael(tm) Smith: formal.xsl; pi.xslMade the dbfunclist PI work as intended. Also added doc for
dbfunclist and dbcmdlist PIs.Michael(tm) Smith: pi.xsl; synop.xslMade the dbcmdlist work the way it appears to have been intended
to work. Restored dbhtml-dir template back to pi.xsl.Michael(tm) Smith: titlepage.xsl; param.xweb; param.entAdded new param abstract.notitle.enabled.
If non-zero, in output of the abstract element on titlepages,
display of the abstracttitle is suppressed.
Because sometimes you really don't want or need that title
there...Michael(tm) Smith: chunk-code.xsl; graphics.xslWhen we are chunking long descriptions for mediaobject instances
into separate HTML output files, and use.id.as.filename is
non-zero, if a mediaobject has an ID, use that ID as the basename
for the long-description file (otherwise, we generate an ID for it
and use that ID as the basename for the file).
The parallels the recent change made to cause IDs for legalnotice
instances to be used as basenames for legalnotice chunks.
Also, made some minor refinements to the recent changes for
legalnotice chunk handling.Michael(tm) Smith: titlepage.xslAdded support to the HTML stylesheets for proper processing of
orgname as a child of author.Michael(tm) Smith: chunk-code.xslWhen $generate.legalnotice.link is non-zero and
$use.id.as.filename is also non-zero, if a legalnotice has an ID,
then instead of assigning the "ln-<generatedID>" basename to the
output file for that legalnotice, just use its real ID as the
basename for the file -- as we do when chunking other elements
that have IDs.David Cramer: xref.xslHandle alt text on xrefs to steps when the step doesn't have a title.David Cramer: lists.xslAdded <p> element around term in variablelist when formatted as table to avoid misalignment of term and listitem in xhtml (non-quirks mode) outputDavid Cramer: qandaset.xslAdded <p> element around question and answer labels to avoid misalignment of label and listitem in xhtml (non-quirks mode) outputDavid Cramer: lists.xslAdded <p> element around callouts to avoid misalignment of callout and listitem in xhtml (non-quirks mode) outputMauritz Jeanson: inline.xslMake citations numbered if bibliography.numbered != 0.Robert Stayton: param.xweb; param.entAdd support for new profiling attributes audience and wordsize.Robert Stayton: inline.xsl; xref.xslAdd support for xlink olinks.Jirka Kosek: glossary.xslRules for normalizing glossary entries before they are sorted can be now different for each language.Robert Stayton: chunk-common.xsl; chunk-code.xsl; manifest.xsl; chunk.xslRefactored the chunking modules to move all named templates to
chunk-common.xsl and all match templates to chunk-code.xsl, in
order to enable better chunk customization.
See the comments in chunk.xsl for more details.Robert Stayton: lists.xslAdd anchor for xml:id for listitem in varlistentry.Robert Stayton: refentry.xslAdd support for info/title in refsections for db5.Jirka Kosek: param.xweb; biblio.xsl; docbook.xsl; param.ent; biblio-iso690.xslAdded support for formatting biblioentries according to ISO690 citation style.
New bibliography style can be turned on by setting parameter bibliography.style to "iso690"
The code was provided by Jana DvorakovaRobert Stayton: inline.xsl; xref.xslAdd call to class.attribute to <a> output elements so they can
have a class value too.Mauritz Jeanson: glossary.xslFixed bug #1644881:
* Added curly braces around all $language attribute values.
* Moved declaration of language variable to top level of stylesheet.
Tested with Xalan, Saxon, and xsltproc.ManpagesThe following changes have been made to the
manpages code
since the 1.72.0 release.Michael(tm) Smith: param.xweb; docbook.xsl; param.entAdded the man.authors.section.enabled and
man.copyright.section.enabled parameters. Set those to zero when
you want to suppress display of the auto-generated AUTHORS and
COPYRIGHT sections. Closes request #1467806. Thanks to Daniel
Leidert.Michael(tm) Smith: docbook.xslTook the test that the manpages stylesheet does to see if there
are any Refentry chilren in current doc, and made it
namespace-agnostic. Reason for that is because the test otherwise
won't work when it is copied over into the generated
profile-docbook.xsl stylesheet.Michael(tm) Smith: MakefileAdded a manpages/profile-docbook.xsl file to enable single-pass
profiling for manpages output.Michael(tm) Smith: info.xslOutput copyright and legalnotice in man-page output in whatever
place they are in in document order. Closes #1690539. Thanks to
Daniel Leidert for reporting.Michael(tm) Smith: docbook.xslRestored support for single-pass namespace stripping to manpages
stylesheet.Michael(tm) Smith: synop.xsl; block.xsl; info.xsl; inline.xsl; lists.xsl; endnotes.xsl; ut⋯Changed handling of bold and italic/underline output in manpages
output. Should be transparent to users, but...
This touches handling of all bold and italic/underline output. The
exact change is that the mode="bold" and mode="italic" utility
templates were changed to named templates. (I think maybe I've
changed it back and forth from mode to named before, so this is
maybe re-reverting it yet again).
Anyway, the reason for the change is that the templates are
sometimes call on dynamically node-sets, and using modes to format
those doesn't allow passing info about the current/real context
node from the source (not the node-set created by the stylesheet)
to that formatting stage.
The named templates allow the context to be passed in as a
parameter, so that the bold/ital formatting template can use
context-aware condition checking.
This was basically necessary in order to suppress bold formatting
in titles, which otherwise gets screwed up because of the numbnut
way that roff handles nested bold/ital.
Closes #1674534). Much thanks to Daniel Leidert, whose in his
docbook-xsl bug-finding kung-fu has achieved Grand Master status.Michael(tm) Smith: block.xslFixed handling of example instances by adding the example element
to the same template we use for processing figure. Closes
#1674538. Thanks to Daniel Leidert.Michael(tm) Smith: utility.xslDon't include lang in manpages filename/pathname if lang=en (that
is, only generate lang-qualified file-/pathnames for non-English).Michael(tm) Smith: endnotes.xslIn manpages output, emit warnings for notesources (footnote, etc.)
that have something other than para as a child.
The numbered-with-hanging-indent formatting that's used for
rendering endnotes in the NOTES section of man pages places some
limits/assumptions on how the DocBook source is marked up; namely,
for notesources (footnote, annotation, etc.) that can contain
block-level children, if the they have a block-level child such as
a table or itemizedlist or orderedlist that is the first child of
a footnote, we have no way of rendering/indenting its content
properly in the endnotes list.
Thus, the manpages stylesheet not emits a warning message for that
case, and suggests the "fix" (which is to wrap the table or
itemizedlist or whatever in a para that has some preferatory text.Michael(tm) Smith: utility.xslAdded support to mixed-block template for handling tables in
mixed-blocks (e.g., as child of para) correctly.Michael(tm) Smith: table.xsl; synop.xsl; block.xsl; info.xsl; lists.xsl; refentry.xsl; end⋯Reverted necessary escaping of backslash, dot, and dash
out of the well-intentioned (but it now appears,
misguided) "marker" mechanism (introduced in the 1.72.0
release) -- which made use of alternative "marker"
characters as internal representations of those
characters, and then replaced them just prior to
serialization -- and back into what's basically the
system that was used prior to the 1.69.0 release; that
is, into a part of stylesheet code that gets executed
at the beginning of processing -- before any other roff
markup up is. This change obviates the need for the
marker system. It also requires a lot less RAM during
processing (for large files, the marker mechanism
ending up requiring gigabytes of memory).
Closes bug #1661177. Thanks to Scott Smedley for
providing a test case (the fvwm man page) that exposed
the problem with the marker mechanism.
Also moved the mechanism for converting non-breaking
spaces back into the same area of the stylesheet code.Michael(tm) Smith: lists.xslFixed problem with incorrect formatting of nested variablelist.
Closes bug #1650931. Thanks to Daniel "Eagle Eye" Leidert.Michael(tm) Smith: lists.xslMake sure that all listitems in itemizedlist and orderedlist are
preceded by a blank line. This fixes a regression that occurred
when instances of the TP macro that were use in a previous
versions of the list-handling code were switched to RS/RE (because
TP doesn't support nesting). TP automatically generates a blank
line, but RS doesn't. So I added a .sp before each .RSMichael(tm) Smith: block.xsl; inline.xsl; param.xweb; docbook.xsl; links.xsl; param.entMade a number of changes related to elements with
out-of-line content:
- Added handling for mediaobject & inlinemediaobject.
Each imagedata, audiodata, or videodata element
within a mediaobject or inline mediaobject is now
treated as a "notesource" and so handled in much the
same way as links and annotation/alt/footnotes.
That means a numbered marker is generated inline to
mark the place in the main flow where the imagedata,
audiodata, or videodata element occurs, and a
corresponding numbered endnote for it is generated in
the endnotes list at the end of the man page; the
endnote contains the URL from the fileref attribute
of the imagedata, audiodata, or videodata element.
For mediobject and inlinemediaobject instances that
have a textobject child, the textobject is displayed
within the main text flow.
- Renamed several man.link.* params to man.endnotes.*,
to reflect that fact that the endnotes list now
contains more than just links. Also did similar
renaming for a number of stylesheet-internal vars.
- Added support for xlink:href (along with existing
support for the legacy ulink element).
- Cleaned up and streamlined the endnotes-handling
code. It's still messy and klunky and the basic
mechanism it uses is very inefficent for documents
that contain a lot of notesources, but at least it's
a bit better than it was.EclipseThe following changes have been made to the
eclipse code
since the 1.72.0 release.Mauritz Jeanson: MakefileFixed bug #1715093: Makefile for creating profiled version of eclipse.xsl added.David Cramer: eclipse.xslAdded normalize-space around to avoid leading whitespace from appearing in the output if there's extra leading whitespace (e.g. <title> Foo</title>) in the sourceJavaHelpThe following changes have been made to the
javahelp code
since the 1.72.0 release.Mauritz Jeanson: javahelp.xslImplemented FR #1230233 (sorted index in javahelp).Mauritz Jeanson: javahelp.xslAdded normalize-space() around titles and index entries to work around whitespace problems.
Added support for glossary and bibliography in toc and map files.RoundtripThe following changes have been made to the
roundtrip code
since the 1.72.0 release.Steve Ball: blocks2dbk.xsl; wordml2normalise.xsl; normalise2sections.xsl; sections2blocks.⋯new stylesheets for better word processor support and easier maintenanceSteve Ball: template-pages.xml; dbk2wp.xsl; sections-spec.xmlfixed bugsParamsThe following changes have been made to the
params code
since the 1.72.0 release.Mauritz Jeanson: htmlhelp.button.back.xml; htmlhelp.button.forward.xml; htmlhelp.button.zo⋯Modified refpurpose text.Mauritz Jeanson: htmlhelp.map.file.xml; htmlhelp.force.map.and.alias.xml; htmlhelp.alias.f⋯Fixed typos, made some small changes.Mauritz Jeanson: javahelp.encoding.xmlMoved declaration and documentation of javahelp.encoding from javahelp.xsl to the
regular "parameter machinery".Mauritz Jeanson: generate.id.attributes.xmlAdded refpurpose text.Mauritz Jeanson: annotation.js.xml; annotation.graphic.open.xml; annotation.graphic.close.⋯Added better refpurpose texts.Michael(tm) Smith: chunker.output.cdata-section-elements.xml; chunker.output.standalone.xm⋯Fixed some broken formatting in source files for chunker.* params,
as pointed out by Dave Pawson.Michael(tm) Smith: label.from.part.xmlChanged handling of reference auto-labeling such that reference
(when it appears at the component level) is now affected by the
label.from.part param, just as preface, chapter, and appendix.Mauritz Jeanson: callout.graphics.extension.xmlClarified that 'extension' refers to file names.Michael(tm) Smith: abstract.notitle.enabled.xmlAdded new param abstract.notitle.enabled.
If non-zero, in output of the abstract element on titlepages,
display of the abstracttitle is suppressed.
Because sometimes you really don't want or need that title
there...Michael(tm) Smith: man.string.subst.map.xmlUpdated manpages string-substitute map to reflect fact that
because of another recent change to suppress bold markup in .SH
output, we no longer need to add a workaround for the accidental
uppercasing of roff escapes that occurred previously.Jirka Kosek: margin.note.float.type.xml; title.font.family.xml; table.frame.border.color.x⋯Improved parameter metadataRobert Stayton: profile.wordsize.xml; profile.audience.xmlAdd support for profiling on new attributes audience and wordsize.Robert Stayton: callout.graphics.number.limit.xml; callout.graphics.extension.xmlAdded SVG graphics for fo output.Robert Stayton: callout.icon.size.xmlSet size of callout graphics.Jirka Kosek: default.units.xml; chunker.output.method.xml; toc.list.type.xml; output.inden⋯Updated parameter metadata to the new format.Jirka Kosek: man.output.quietly.xml; title.font.family.xml; footnote.sep.leader.properties⋯Added type annotations into parameter definition files.Robert Stayton: section.container.element.xmlSupport spans in sections for certain processors.Robert Stayton: component.titlepage.properties.xmlEmpty attribute set for top level component titlepage block.
Allows setting a span on titleinfo.Jirka Kosek: bibliography.style.xmlAdded link to WiKi page with description of special markup needed for ISO690 biblioentriesRobert Stayton: make.year.ranges.xmlClarify that multiple year elements are required.Robert Stayton: id.warnings.xmlTurn off id.warnings by default.Jirka Kosek: bibliography.style.xmlAdded support for formatting biblioentries according to ISO690 citation style.
New bibliography style can be turned on by setting parameter bibliography.style to "iso690"
The code was provided by Jana DvorakovaRobert Stayton: header.table.properties.xml; footer.table.properties.xmlSupport adding table properties to header and footer tables.HighlightingThe following changes have been made to the
highlighting code
since the 1.72.0 release.Jirka Kosek: c-hl.xml; xslthl-config.xmlAdded support for C language. Provided by Bruno Guegan.ProfilingThe following changes have been made to the
profiling code
since the 1.72.0 release.Robert Stayton: profile-mode.xslAdd support for new profiling attributes audience and wordsize.LibThe following changes have been made to the
lib code
since the 1.72.0 release.Michael(tm) Smith: lib.xwebChanged name of prepend-pad template to pad-string and twheeked so
it can do both right/left padding.ToolsThe following changes have been made to the
tools code
since the 1.72.0 release.Michael(tm) Smith: bin; bin/docbook-xsl-updateDid some cleanup to the install.sh source and added a
docbook-xsl-update script to the docbook-xsl distro, the purpose
of which is to facilitate easy sync-up to the latest docbook-xsl
snapshot (by means of rsync).XSL-SaxonThe following changes have been made to the
xsl-saxon code
since the 1.72.0 release.Mauritz Jeanson: xalan27/src/com/nwalsh/xalan/Verbatim.java; xalan27/src/com/nwalsh/xalan/⋯Added modifications so that the new callout.icon.size parameter is taken into account. This
parameter is used for FO output (where SVG now is the default graphics format for callouts).Mauritz Jeanson: saxon65/src/com/nwalsh/saxon/FormatCallout.java; xalan27/src/com/nwalsh/x⋯Added code for generating id attributes on callouts in HTML and FO output.
These patches enable cross-references to callouts placed by area coordinates.
It works for graphic, unicode and text callouts.
Part of fix for bug #1675513 (xref to area broken).Michael(tm) Smith: saxon65/src/com/nwalsh/saxon/Website.java; xalan27/src/com/nwalsh/xalan⋯Copied over Website XSL Java extensions.XSL-XalanThe following changes have been made to the
xsl-xalan code
since the 1.72.0 release.Michael(tm) Smith: Makefile; xalan2Turned off xalan2.jar build. This removes DocBook XSL
Java extensions support for versions of Xalan prior to
Xalan 2.7. If you are currently using the extensions
with an earlier version of Xalan, you need to upgrade
to Xalan 2.7.Mauritz Jeanson: xalan27/src/com/nwalsh/xalan/Verbatim.java; xalan27/src/com/nwalsh/xalan/⋯Added modifications so that the new callout.icon.size parameter is taken into account. This
parameter is used for FO output (where SVG now is the default graphics format for callouts).Mauritz Jeanson: saxon65/src/com/nwalsh/saxon/FormatCallout.java; xalan27/src/com/nwalsh/x⋯Added code for generating id attributes on callouts in HTML and FO output.
These patches enable cross-references to callouts placed by area coordinates.
It works for graphic, unicode and text callouts.
Part of fix for bug #1675513 (xref to area broken).Michael(tm) Smith: saxon65/src/com/nwalsh/saxon/Website.java; xalan27/src/com/nwalsh/xalan⋯Copied over Website XSL Java extensions.Release: 1.72.0This release includes important bug fixes and adds the following
significant feature changes:
Automatic sorting of glossary entriesThe HTML and FO stylesheets now support automatic sorting
of glossary entries. To enable glossary sorting, set
the value of the glossary.sort parameter
to 1 (by default, it’s value is
0). When you enable glossary sorting,
glossentry elements within a glossary,
glossdiv, or glosslist are sorted on the
glossterm, using the current language setting. If you
don’t enable glossary sorting, then the order of
glossentry elements is left “as is” — that is, they
are not sorted but are instead just displayed in document
order.WordML renamed to Roundtrip, OpenOffice support addedStylesheets for “roundtrip” conversion between documents in
OpenOffice format (ODF) and DocBook XML have been added to the set
of stylesheets that formerly had the collective title
WordML, and that set of stylesheets has
been renamed to Roundtrip to better
reflect the actual scope and purpose of its contents.So the DocBook XSL Stylesheets now support roundtrip
conversion (with certain limitations) of WordML, OpenOffice, and
Apple Pages documents to and from DocBook XML.Including QandASet questions in TOCsThe HTML stylesheet now provides support for including
QandASetquestions in the document TOC. To
enable display of questions in the document TOC, set
the value of the qanda.in.toc to
1 (by default, it’s 0). When you
enable qanda.in.toc, then the generated
table of contents for a document will include
qandaset titles, qandadiv titles, and
question elements. The default value of zero
excludes them from the TOC.
The qanda.in.toc parameter does
not affect any tables of contents that may be generated
within a qandaset or
qandadiv (only in the document TOC).Language identifier in man-page filenames and pathnamesAdded new parameter man.output.lang.in.name.enabled, which controls whether
a language identifier is included in man-page filenames and
pathnames. It works like this:If the value of man.output.lang.in.name.enabled is non-zero,
man-page files are output with a language identifier included in
their filenames or pathnames as follows:if
man.output.subdirs.enabled is non-zero,
each file is output to, e.g., a
/$lang/man8/foo.8 pathnameif
man.output.subdirs.enabled is zero,
each file is output with a foo.$lang.8
filenameindex.page.number.properties property setFor FO output, use the
index.page.number.properties to control
formatting of page numbers in index output — to (for
example) to display page numbers in index output in a
different color (to indicate that they are links).Crop marks in output from Antenna House XSL FormatterSupport has been added for generating crop marks in
print/PDF output generated using Antenna House XSL FormatterMore string-substitution hooks in manpages outputThe man.string.subst.map.local.pre
and man.string.subst.map.local.post
parameters have been added to enable easier control over
custom string substitutions.Moved verbatim properties to attribute-setThe hardcoded properties used in verbatim elements (literallayout,
programlisting, screen) were moved to the verbatim.properties
attribute-set so they can be more easily customized.enhanced simple.xlink templateNow the simple.xlink template in inline.xsl works with
cross reference elements xref and link as well. Also, more elements
call simple.xlink, which enables DB5 xlink functionality.
DocBook 5 compatibilityStylesheets now consistently support DocBook 5 attributes
(such as xml:id). Also, DocBook 5 info elements are now checked
along with other *info elements, and the use of name() function
was replaced by local-name() so it also matches on DocBook 5 elements.
These changes enable reusing the stylesheets with DocBook 5
documents with minimal fixup.
HTML class attributes now handled in class.attribute mode The HTML class attributes were formerly hardcoded to the
element name. Now the class attribute is generated by applying
templates in class.attribute mode so class attribute names
can be customized. The default is still the element name.arabic-indic numbering enabled in autolabelsNumbering of chapter, sections, and pages can now use
arabic-indic numbering when number format is set to 'arabicindic' or
to ١.
The following is a detailed list of changes (not
including bug fixes) that have been made since the 1.71.1
release.CommonThe following changes have been made to the
common code
since the 1.71.1 release.Add support for arabicindic numbering to autolabel.format template.M: /trunk/xsl/common/labels.xsl - Robert StaytonFinish support for @xml:id everywhere @id is used.M: /trunk/xsl/common/gentext.xsl; M: /trunk/xsl/common/titles.xsl - Robert Staytonreplace name() with local-name() in most cases.M: /trunk/xsl/common/l10n.xsl; M: /trunk/xsl/common/olink.xsl; M: /trunk/xsl/common/subtitles.xsl; M: /trunk/xsl/common/labels.xsl; M: /trunk/xsl/common/titles.xsl; M: /trunk/xsl/common/common.xsl - Robert StaytonAdd support for info.M: /trunk/xsl/common/subtitles.xsl; M: /trunk/xsl/common/labels.xsl; M: /trunk/xsl/common/titles.xsl; M: /trunk/xsl/common/common.xsl; M: /trunk/xsl/common/targets.xsl - Robert StaytonAdd utility template tabstyle to return the tabstyle from
any table element.M: /trunk/xsl/common/table.xsl - Robert StaytonFOThe following changes have been made to the
fo code
since the 1.71.1 release.Add support for sorting glossary entriesM: /trunk/xsl/fo/param.xweb; M: /trunk/xsl/fo/param.ent; M: /trunk/xsl/fo/glossary.xsl - Robert StaytonAdd table.row.properties template to customize table rows.M: /trunk/xsl/fo/table.xsl - Robert StaytonMoved all properties to attribute-sets so can be customized more easily.M: /trunk/xsl/fo/verbatim.xsl - Robert StaytonAdd index.page.number.properties attribute-set to format page numbers.M: /trunk/xsl/fo/autoidx.xsl - Robert Staytonxref now supports xlink:href, using simple.xlink template.M: /trunk/xsl/fo/xref.xsl - Robert StaytonRewrote simple.xlink, and call it with all charseq templates.M: /trunk/xsl/fo/inline.xsl - Robert StaytonAdd simple.xlink processing to term and member elements.M: /trunk/xsl/fo/lists.xsl - Robert StaytonAdd support for crop marks in Antenna House.M: /trunk/xsl/fo/axf.xsl; M: /trunk/xsl/fo/pagesetup.xsl - Robert StaytonHTMLThe following changes have been made to the
html code
since the 1.71.1 release.Add support for sorting glossary entriesM: /trunk/xsl/html/glossary.xsl - Robert StaytonAdd support for qanda.in.toc to add qandaentry questions to document TOC.M: /trunk/xsl/html/autotoc.xsl; M: /trunk/xsl/html/param.xweb; M: /trunk/xsl/html/param.ent - Robert Staytonadd simple.xlink support to variablelistterm and simplelistmember.M: /trunk/xsl/html/lists.xsl - Robert Stayton*.propagates.style now handled in class.attribute mode.M: /trunk/xsl/html/inline.xsl; M: /trunk/xsl/html/lists.xsl; M: /trunk/xsl/html/table.xsl; M: /trunk/xsl/html/block.xsl; M: /trunk/xsl/html/footnote.xsl - Robert Staytonadd class parameter to class.attribute mode to set default class.M: /trunk/xsl/html/html.xsl - Robert StaytonConvert all class attributes to use the class.attribute mode
so class names can be customized more easily.M: /trunk/xsl/html/titlepage.xsl; M: /trunk/xsl/html/chunk-code.xsl; M: /trunk/xsl/html/division.xsl; M: /trunk/xsl/html/sections.xsl; M: /trunk/xsl/html/math.xsl; M: /trunk/xsl/html/block.xsl; M: /trunk/xsl/html/info.xsl; M: /trunk/xsl/html/footnote.xsl; M: /trunk/xsl/html/lists.xsl; M: /trunk/xsl/html/admon.xsl; M: /trunk/xsl/html/refentry.xsl; M: /trunk/xsl/html/qandaset.xsl; M: /trunk/xsl/html/graphics.xsl; M: /trunk/xsl/html/biblio.xsl; M: /trunk/xsl/html/task.xsl; M: /trunk/xsl/html/component.xsl; M: /trunk/xsl/html/glossary.xsl; M: /trunk/xsl/html/callout.xsl; M: /trunk/xsl/html/index.xsl; M: /trunk/xsl/html/synop.xsl; M: /trunk/xsl/html/verbatim.xsl; M: /trunk/xsl/html/ebnf.xsl - Robert StaytonAdd class.attribute mode to generate class attributes.M: /trunk/xsl/html/html.xsl - Robert StaytonAdded simple.xlink to most remaining inlines.
Changed class attributes to applying class.attributes mode.M: /trunk/xsl/html/inline.xsl - Robert StaytonChanged xref template to use simple.xlink tempalte.M: /trunk/xsl/html/xref.xsl - Robert StaytonImprove generate.html.title to work with link targets too.M: /trunk/xsl/html/html.xsl - Robert StaytonImproved simple.xlink to support link and xref.M: /trunk/xsl/html/inline.xsl - Robert StaytonUse new link.title.attribute now.M: /trunk/xsl/html/xref.xsl - Robert StaytonRewrote simple.xlink to handle linkend also.
Better computation of title attribute on link too.M: /trunk/xsl/html/inline.xsl - Robert StaytonHandle Xalan quirk as special case.M: /trunk/xsl/html/db5strip.xsl - Robert StaytonAdd support for info.M: /trunk/xsl/html/admon.xsl; M: /trunk/xsl/html/autotoc.xsl; M: /trunk/xsl/html/lists.xsl; M: /trunk/xsl/html/refentry.xsl; M: /trunk/xsl/html/biblio.xsl; M: /trunk/xsl/html/qandaset.xsl; M: /trunk/xsl/html/component.xsl; M: /trunk/xsl/html/glossary.xsl; M: /trunk/xsl/html/division.xsl; M: /trunk/xsl/html/index.xsl; M: /trunk/xsl/html/sections.xsl; M: /trunk/xsl/html/table.xsl; M: /trunk/xsl/html/block.xsl - Robert StaytonFixed imagemaps so they work properly going from calspair coords
to HTML area coords.M: /trunk/xsl/html/graphics.xsl - Robert StaytonManpagesThe following changes have been made to the
manpages code
since the 1.71.1 release.Added doc for man.output.lang.in.name.enabled parameter. This
checkin completes support for writing file/pathnames for man-pages
with $lang include in the names. Closes #1585967. knightly
accolades to Daniel Leidert for providing the feature request.M: /trunk/xsl/manpages/param.xweb; M: /trunk/xsl/manpages/param.ent - Michael(tm) SmithAdded new param man.output.lang.in.name.enabled, which
controls whether $LANG value is included in manpages
filenames and pathnames. It works like this:
If the value of man.output.lang.in.name.enabled is non-zero,
man-page files are output with the $lang value included in
their filenames or pathnames as follows;
- if man.output.subdirs.enabled is non-zero, each file is
output to, e.g., a /$lang/man8/foo.8 pathname
- if man.output.subdirs.enabled is zero, each file is output
with a foo.$lang.8 filenameM: /trunk/xsl/manpages/docbook.xsl; M: /trunk/xsl/manpages/other.xsl; M: /trunk/xsl/manpages/utility.xsl - Michael(tm) SmithUse "\e" instead of "\\" for backslash output, because the
groff docs say that's the correct thing to do; also because
testing (thanks, Paul Dubois) shows that "\\" doesn't always
work as expected; for example, "\\" within a table seems to
mess things up.M: /trunk/xsl/manpages/charmap.groff.xsl - Michael(tm) SmithAdded the man.string.subst.map.local.pre and
man.string.subst.map.local.post parameters. Those parameters
enable local additions and changes to string-substitution mappings
without the need to change the value of man.string.subst.map
parameter (which is for standard system mappings). Closes
#1456738. Thanks to Sam Steingold for constructing a true
stylesheet torture test (the clisp docs) that exposed the need for
these params.M: /trunk/xsl/manpages/param.xweb; M: /trunk/xsl/manpages/param.ent; M: /trunk/xsl/manpages/other.xsl - Michael(tm) SmithAdded the Markup element to the list of elements that get output
in bold. Thanks to Eric S. Raymond.M: /trunk/xsl/manpages/inline.xsl - Michael(tm) SmithReplaced all dots in roff requests with U+2302 ("house"
character), and added escaping in output for all instances of dot
that are not in roff requests. This fixes the problem case where a
string beginning with a dot (for example, the string ".bashrc")
might occur at the beginning of a line in output, in which case
would mistakenly get interpreted as a roff request. Thanks to Eric
S. Raymond for pushing to fix this.M: /trunk/xsl/manpages/table.xsl; M: /trunk/xsl/manpages/synop.xsl; M: /trunk/xsl/manpages/block.xsl; M: /trunk/xsl/manpages/info.xsl; M: /trunk/xsl/manpages/lists.xsl; M: /trunk/xsl/manpages/refentry.xsl; M: /trunk/xsl/manpages/links.xsl; M: /trunk/xsl/manpages/other.xsl; M: /trunk/xsl/manpages/utility.xsl - Michael(tm) SmithMade change to ensure that list content nested in
itemizedlist and orderedlist instances is properly indented. This
is a switch from using .TP to format those lists to using .RS/.RE
to format them instead (because .TP does not allow nesting). Closes bug #1602616.
Thanks to Daniel Leidert.M: /trunk/xsl/manpages/lists.xsl - Michael(tm) SmithParamsThe following changes have been made to the
params code
since the 1.71.1 release.Added doc for man.output.lang.in.name.enabled parameter. This
checkin completes support for writing file/pathnames for man-pages
with $lang include in the names. Closes #1585967. knightly
accolades to Daniel Leidert for providing the feature request.A: /trunk/xsl/params/man.output.lang.in.name.enabled.xml - Michael(tm) SmithAdded new param man.output.lang.in.name.enabled, which
controls whether $LANG value is included in manpages
filenames and pathnames. It works like this:
If the value of man.output.lang.in.name.enabled is non-zero,
man-page files are output with the $lang value included in
their filenames or pathnames as follows;
- if man.output.subdirs.enabled is non-zero, each file is
output to, e.g., a /$lang/man8/foo.8 pathname
- if man.output.subdirs.enabled is zero, each file is output
with a foo.$lang.8 filenameM: /trunk/xsl/manpages/docbook.xsl; M: /trunk/xsl/manpages/other.xsl; M: /trunk/xsl/manpages/utility.xsl - Michael(tm) SmithAdded the man.string.subst.map.local.pre and
man.string.subst.map.local.post parameters. Those parameters
enable local additions and changes to string-substitution mappings
without the need to change the value of man.string.subst.map
parameter (which is for standard system mappings). Closes
#1456738. Thanks to Sam Steingold for constructing a true
stylesheet torture test (the clisp docs) that exposed the need for
these params.A: /trunk/xsl/params/man.string.subst.map.local.post.xml; A: /trunk/xsl/params/man.string.subst.map.local.pre.xml; M: /trunk/xsl/params/man.string.subst.map.xml - Michael(tm) SmithAdd index.page.number.properties by default.M: /trunk/xsl/params/xep.index.item.properties.xml - Robert StaytonAdded index.page.number.properties to allow customizations of page numbers in indexes.A: /trunk/xsl/params/index.page.number.properties.xml - Robert StaytonMove show-destination="replace" property from template to attribute-set
so it can be customized.M: /trunk/xsl/params/olink.properties.xml - Robert StaytonAdd support for sorting glossary entriesA: /trunk/xsl/params/glossary.sort.xml - Robert StaytonAdd option to include qanda in tables of contents.A: /trunk/xsl/params/qanda.in.toc.xml - Robert StaytonMoved all properties to attribute-sets so can be customized more easily.M: /trunk/xsl/params/verbatim.properties.xml - Robert StaytonTemplateThe following changes have been made to the
template code
since the 1.71.1 release.Added workaround for Xalan bug: use for-each and copy instead of copy-of (#1604770).M: /trunk/xsl/template/titlepage.xsl - Mauritz JeansonRoundtripThe following changes have been made to the
roundtrip code
since the 1.71.1 release.rename to roundtrip, add OpenOffice supportM: /trunk/xsl/roundtrip/docbook-pages.xsl; M: /trunk/xsl/roundtrip/specifications.xml; A: /trunk/xsl/roundtrip/dbk2ooo.xsl; M: /trunk/xsl/roundtrip/docbook.xsl; A: /trunk/xsl/roundtrip/dbk2pages.xsl; M: /trunk/xsl/roundtrip/template.xml; A: /trunk/xsl/roundtrip/dbk2wordml.xsl; A: /trunk/xsl/roundtrip/dbk2wp.xsl; M: /trunk/xsl/roundtrip/template.dot; M: /trunk/xsl/roundtrip/wordml-final.xsl - Steve BallRelease: 1.71.1This is a minor update to the 1.71.0 release. Along with a
number of bug fixes, it includes two feature changes:
Added support for profiling based on xml:lang and status attributes.Added initial support in manpages output for
footnote, annotation, and alt
instances. Basically, they all now get handled the same way
ulink instances are. They are treated as a class as
"note sources": A numbered marker is generated at the place in the
main text flow where they occur, then their contents are displayed
in an endnotes section at the end of the man page.CommonThe following changes have been made to the
common code
since the 1.71.1 release.For backward compatability autoidx-ng.xsl is invoking "kosek" indexing method again.D: /trunk/xsl/common/autoidx-ng.xsl - Jirka KosekAdd support for Xalan generating a root xml:base like saxon.M: /trunk/xsl/common/stripns.xsl - Robert StaytonFOThe following changes have been made to the
fo code
since the 1.71.1 release.For backward compatability autoidx-ng.xsl is invoking "kosek" indexing method again.M: /trunk/xsl/fo/autoidx-ng.xsl; M: /trunk/xsl/fo/autoidx-kosek.xsl - Jirka KosekAdd support for Xalan to add root node xml:base for db5 docs.M: /trunk/xsl/fo/docbook.xsl - Robert StaytonAdded support for profiling based on xml:lang and status attributes.M: /trunk/xsl/fo/param.xweb; M: /trunk/xsl/fo/param.ent - Jirka KosekHTMLThe following changes have been made to the
html code
since the 1.71.1 release.For backward compatability autoidx-ng.xsl is invoking "kosek" indexing method again.M: /trunk/xsl/html/autoidx-ng.xsl; M: /trunk/xsl/html/autoidx-kosek.xsl - Jirka KosekAdd support for Xalan to add root node xml:base for db5 docs.M: /trunk/xsl/html/chunk-code.xsl; M: /trunk/xsl/html/docbook.xsl - Robert StaytonAdded support for profiling based on xml:lang and status attributes.M: /trunk/xsl/html/param.xweb; M: /trunk/xsl/html/param.ent - Jirka KosekMade changes in namespace declarations to prevent xmllint's
canonicalizer from treating them as relative namespace URIs.
- Changed xmlns:k="java:com.isogen.saxoni18n.Saxoni18nService"
to xmlns:k="http://www.isogen.com/functions/com.isogen.saxoni18n.Saxoni18nService";
Saxon accepts either form
(see http://www.saxonica.com/documentation/extensibility/functions.html);
to Saxon, "the part of the URI before the final '/' is immaterial".
- Changed, e.g. xmlns:xverb="com.nwalsh.xalan.Verbatim" to
xmlns:xverb="xalan://com.nwalsh.xalan.Verbatim"; Xalan accepts
either form
(see http://xml.apache.org/xalan-j/extensions.html#java-namespace-declare);
just as Saxon does, it will "simply use the string to the
right of the rightmost forward slash as the Java class name".
- Changed xmlns:xalanredirect="org.apache.xalan.xslt.extensions.Redirect"
to xmlns:redirect="http://xml.apache.org/xalan/redirect", and
adjusted associated code to make the current Xalan redirect spec.
(see http://xml.apache.org/xalan-j/apidocs/org/apache/xalan/lib/Redirect.html)M: /trunk/xsl/html/oldchunker.xsl; M: /trunk/xsl/html/chunker.xsl; M: /trunk/xsl/html/graphics.xsl; M: /trunk/xsl/html/callout.xsl; M: /trunk/xsl/html/autoidx-kimber.xsl; M: /trunk/xsl/html/autoidx-kosek.xsl; M: /trunk/xsl/html/table.xsl; M: /trunk/xsl/html/verbatim.xsl - Michael(tm) SmithAdded the html.append and chunk.append parameters. By default, the
value of both is empty; but the internal DocBook XSL stylesheets
build sets their value to "<xsl:text>
</xsl:text>", in order
to ensure that all files in the docbook-xsl-doc package end in a
newline character. (Because diff and some other tools may emit
error messages and/or not behave as expected when processing
files that are not newline-terminated.)M: /trunk/xsl/html/chunk-common.xsl; M: /trunk/xsl/html/titlepage.xsl; M: /trunk/xsl/html/param.xweb; M: /trunk/xsl/html/docbook.xsl; M: /trunk/xsl/html/graphics.xsl; M: /trunk/xsl/html/param.ent - Michael(tm) SmithHighlightingThe following changes have been made to the
highlighting code
since the 1.71.1 release.Added license informationM: /trunk/xsl/highlighting/delphi-hl.xml; M: /trunk/xsl/highlighting/myxml-hl.xml; M: /trunk/xsl/highlighting/php-hl.xml; M: /trunk/xsl/highlighting/m2-hl.xml; M: /trunk/xsl/highlighting/ini-hl.xml; M: /trunk/xsl/highlighting/xslthl-config.xml; M: /trunk/xsl/highlighting/java-hl.xml - Jirka KosekManpagesThe following changes have been made to the
manpages code
since the 1.71.1 release.Added initial support in manpages output for footnote, annotation,
and alt instances. Basically, they all now get handled the same
way ulink instances are. They are treated as a class as "note
sources": A numbered marker is generated at the place in the main
text flow where they occur, then their contents are displayed in
an endnotes section at the end of the man page (currently titled
REFERENCES, for English output, but will be changed to NOTES).
This support is not yet complete. It works for most "normal"
cases, but probably mishandles a good number of cases. More
testing will be needed to expose the problems. It may well also
introduce some bugs and regressions in other areas, including
basic paragraph handling, handling of "mixed block" content,
handling of other indented content, and handling of authorblurb
and personblurb in the AUTHORS section.M: /trunk/xsl/manpages/table.xsl; M: /trunk/xsl/manpages/block.xsl; M: /trunk/xsl/manpages/docbook.xsl; M: /trunk/xsl/manpages/links.xsl; M: /trunk/xsl/manpages/other.xsl; M: /trunk/xsl/manpages/utility.xsl - Michael(tm) SmithParamsThe following changes have been made to the
params code
since the 1.71.1 release.Added support for profiling based on xml:lang and status attributes.A: /trunk/xsl/params/profile.status.xml - Jirka KosekAdded the html.append and chunk.append parameters. By default, the
value of both is empty; but the internal DocBook XSL stylesheets
build sets their value to "<xsl:text>
</xsl:text>", in order
to ensure that all files in the docbook-xsl-doc package end in a
newline character. (Because diff and some other tools may emit
error messages and/or not behave as expected when processing
files that are not newline-terminated.)A: /trunk/xsl/params/html.append.xml; A: /trunk/xsl/params/chunk.append.xml - Michael(tm) SmithProfilingThe following changes have been made to the
profiling code
since the 1.71.1 release.Added support for profiling based on xml:lang and status attributes.M: /trunk/xsl/profiling/profile.xsl; M: /trunk/xsl/profiling/profile-mode.xsl - Jirka KosekRelease: 1.71.0This is mainly a bug fix release, but it also includes two
significant feature changes:
Highlighting support addedThe stylesheets now include support for source-code
highlighting in output of programlisting instances (controlled
through the highlight.source
parameter). The Java-based implementation requires Saxon and
makes use of MichalMolhanec’s XSLTHL. More details are available at Jirka Kosek’s
website:
The support is currently limited to highlighting
of XML, Java, PHP, Delphi, Modula-2 sources, and INI
files.Changes to autoindexingThe templates that handle alternative indexing methods
were reworked to avoid errors produced by certain processors not
being able to tolerate the presence of unused functions. With
this release, none of the code for the 'kimber' or 'kosek'
methods is included in the default stylesheets. In order to use
one of those methods, your customization layer must import one
of the optional stylesheet modules:html/autoidx-kosek.xslhtml/autoidx-kimber.xslfo/autoidx-kosek.xslfo/autoidx-kimber.xsl
See the index.method parameter
reference page for more information.
Two other changes to note:
The default indexing method now can handle accented
characters in latin-based alphabets, not just English. This
means accented latin letters will group and sort with their
unaccented counterpart.The default value for the
index.method parameter was changed
from 'english' to 'basic' because now the default method can
handle latin-based alphabets, not just English.
The following is a list of changes that have
been made since the 1.70.1 release.CommonThe following changes have been made to the
common code
since the 1.70.1 release.Added reference.autolabel parameter for controlling labels on
reference output.M: /trunk/xsl/common/labels.xsl - Michael(tm) SmithSupport rows that are *completely* overlapped by the preceding rowM: /trunk/xsl/common/table.xsl - Norman WalshNew modules for supporting indexing extensions.A: /trunk/xsl/common/autoidx-kimber.xsl; A: /trunk/xsl/common/autoidx-kosek.xsl - Robert StaytonSupport startinglinenumber on orderedlistM: /trunk/xsl/common/common.xsl - Norman WalshExtensionsThe following changes have been made to the
extensions code
since the 1.70.1 release.Completely reworked extensions build system; now uses NetBeans and antD: /trunk/xsl/extensions/xalan27/.cvsignore; A: /trunk/xsl/extensions/saxon65/nbproject; A: /trunk/xsl/extensions/saxon65/nbproject/project.properties; D: /trunk/xsl/extensions/prj.el; A: /trunk/xsl/extensions/saxon65/src; A: /trunk/xsl/extensions/xalan2/src/com; M: /trunk/xsl/extensions/xalan2/src/com/nwalsh/xalan/Text.java; A: /trunk/xsl/extensions/saxon65/nbproject/project.xml; D: /trunk/xsl/extensions/build.xml; A: /trunk/xsl/extensions/saxon65/build.xml; A: /trunk/xsl/extensions/xalan2/nbproject/genfiles.properties; A: /trunk/xsl/extensions/saxon65; D: /trunk/xsl/extensions/xalan2/com; M: /trunk/xsl/extensions/xalan2/src/com/nwalsh/xalan/Func.java; A: /trunk/xsl/extensions/xalan2/test; A: /trunk/xsl/extensions/saxon65/src/com; A: /trunk/xsl/extensions/xalan2/nbproject/build-impl.xml; A: /trunk/xsl/extensions/xalan2/nbproject; A: /trunk/xsl/extensions/xalan2/src; A: /trunk/xsl/extensions/xalan2/nbproject/project.properties; D: /trunk/xsl/extensions/.cvsignore; M: /trunk/xsl/extensions/Makefile; D: /trunk/xsl/extensions/saxon8; A: /trunk/xsl/extensions/saxon65/nbproject/genfiles.properties; A: /trunk/xsl/extensions/xalan2/nbproject/project.xml; A: /trunk/xsl/extensions/saxon65/test; M: /trunk/xsl/extensions/xalan2/src/com/nwalsh/xalan/Verbatim.java; A: /trunk/xsl/extensions/xalan2/build.xml; M: /trunk/xsl/extensions/xalan2; D: /trunk/xsl/extensions/saxon643; A: /trunk/xsl/extensions/saxon65/nbproject/build-impl.xml - Norman WalshFOThe following changes have been made to the
fo code
since the 1.70.1 release.xsl:sort lang attribute now uses two-char substring of lang attribute.M: /trunk/xsl/fo/autoidx-kimber.xsl - Robert StaytonSupport titlecase "Java", "Perl", and "IDL" as values for the
language attribute on classsynopsis, etc. (instead of just
lowercase "java", "perl", and "idl"). Also support "c++" and "C++"
(instead of just "cpp").
Affects HTML, FO, and manpages output. Closes bug 1552332. Thanks
to "Brian A. Vanderburg II".M: /trunk/xsl/fo/synop.xsl - Michael(tm) SmithAdded support for the reference.autolabel param in (X)HTML and FO
output.M: /trunk/xsl/fo/param.xweb; M: /trunk/xsl/fo/param.ent - Michael(tm) SmithSupport rows that are *completely* overlapped by the preceding rowM: /trunk/xsl/fo/table.xsl - Norman WalshRearranged templates for the 3 indexing methods
and changed method named 'english' to 'basic'.M: /trunk/xsl/fo/autoidx.xsl - Robert StaytonNew modules for supporting indexing extensions.A: /trunk/xsl/fo/autoidx-kimber.xsl; A: /trunk/xsl/fo/autoidx-kosek.xsl - Robert StaytonTurn off blank-body for fop1.extensions too since fop 0.92
does not support it either.M: /trunk/xsl/fo/pagesetup.xsl - Robert StaytonAdd Xalan variant to test for exslt:node-set function.
Xalan can use function named node-set(), but doesn't
recognize it using function-available().M: /trunk/xsl/fo/autoidx.xsl - Robert StaytonAdded support to FO stylesheets for handling instances of Org
where it occurs outside of *info content. In HTML stylesheets,
moved handling of Org out of info.xsl and into inline.xsl. In both
FO and HTML stylesheets, added support for correctly processing
Affiliation and Jobtitle.M: /trunk/xsl/fo/inline.xsl - Michael(tm) SmithDon't output punctuation between Refname and Refpurpose if
Refpurpose is empty. Also corrected handling of Refsect2/title
instances, and removed some debugging stuff that was generated in
manpages output to mark the ends of sections.M: /trunk/xsl/fo/refentry.xsl - Michael(tm) SmithAdded new email.delimiters.enabled param. If non-zero (the
default), delimiters are generated around e-mail addresses (output
of the email element). If zero, the delimiters are suppressed.M: /trunk/xsl/fo/inline.xsl; M: /trunk/xsl/fo/param.xweb; M: /trunk/xsl/fo/param.ent - Michael(tm) SmithInitial support of syntax highlighting of programlistings.M: /trunk/xsl/fo/param.ent; M: /trunk/xsl/fo/param.xweb; A: /trunk/xsl/fo/highlight.xsl; M: /trunk/xsl/fo/verbatim.xsl - Jirka KosekChapter after preface should restart numbering of pages.M: /trunk/xsl/fo/pagesetup.xsl - Jirka KosekHTMLThe following changes have been made to the
html code
since the 1.70.1 release.xsl:sort lang attribute now uses two-char substring of lang attribute.M: /trunk/xsl/html/autoidx-kimber.xsl - Robert StaytonSupport titlecase "Java", "Perl", and "IDL" as values for the
language attribute on classsynopsis, etc. (instead of just
lowercase "java", "perl", and "idl"). Also support "c++" and "C++"
(instead of just "cpp").
Affects HTML, FO, and manpages output. Closes bug 1552332. Thanks
to "Brian A. Vanderburg II".M: /trunk/xsl/html/synop.xsl - Michael(tm) SmithAdded support for the reference.autolabel param in (X)HTML and FO
output.M: /trunk/xsl/html/param.xweb; M: /trunk/xsl/html/param.ent - Michael(tm) SmithSupport rows that are *completely* overlapped by the preceding rowM: /trunk/xsl/html/table.xsl - Norman WalshRearranged templates for the 3 indexing methods
and changed method named 'english' to 'basic'.M: /trunk/xsl/html/autoidx.xsl - Robert StaytonNew modules for supporting indexing extensions.A: /trunk/xsl/html/autoidx-kimber.xsl; A: /trunk/xsl/html/autoidx-kosek.xsl - Robert StaytonAdded several new HTML parameters for controlling appearance of
content on HTML title pages:
contrib.inline.enabled:
If non-zero (the default), output of the contrib element is
displayed as inline content rather than as block content.
othercredit.like.author.enabled:
If non-zero, output of the othercredit element on titlepages is
displayed in the same style as author and editor output. If zero
(the default), othercredit output is displayed using a style
different than that of author and editor.
blurb.on.titlepage.enabled:
If non-zero, output from authorblurb and personblurb elements is
displayed on title pages. If zero (the default), output from
those elements is suppressed on title pages (unless you are
using a titlepage customization that causes them to be included).
editedby.enabled
If non-zero (the default), a localized Edited by heading is
displayed above editor names in output of the editor element.M: /trunk/xsl/html/titlepage.xsl; M: /trunk/xsl/html/param.xweb; M: /trunk/xsl/html/param.ent - Michael(tm) SmithAdd Xalan variant to test for exslt:node-set function.
Xalan can use function named node-set(), but doesn't
recognize it using function-available().M: /trunk/xsl/html/autoidx.xsl - Robert StaytonAdded support to FO stylesheets for handling instances of Org
where it occurs outside of *info content. In HTML stylesheets,
moved handling of Org out of info.xsl and into inline.xsl. In both
FO and HTML stylesheets, added support for correctly processing
Affiliation and Jobtitle.M: /trunk/xsl/html/inline.xsl; M: /trunk/xsl/html/info.xsl - Michael(tm) SmithDon't output punctuation between Refname and Refpurpose if
Refpurpose is empty. Also corrected handling of Refsect2/title
instances, and removed some debugging stuff that was generated in
manpages output to mark the ends of sections.M: /trunk/xsl/html/refentry.xsl - Michael(tm) SmithAdded new email.delimiters.enabled param. If non-zero (the
default), delimiters are generated around e-mail addresses (output
of the email element). If zero, the delimiters are suppressed.M: /trunk/xsl/html/inline.xsl; M: /trunk/xsl/html/param.xweb; M: /trunk/xsl/html/param.ent - Michael(tm) SmithAdded qanda.nested.in.toc param. Default value is zero. If
non-zero, instances of "nested" Qandaentry (ones that are children
of Answer elements) are displayed in the TOC. Closes patch 1509018
(from Daniel Leidert). Currently on affects HTML output (no patch
for FO output provided).M: /trunk/xsl/html/param.xweb; M: /trunk/xsl/html/param.ent; M: /trunk/xsl/html/qandaset.xsl - Michael(tm) SmithImproved handling of relative locations generated filesM: /trunk/xsl/html/html.xsl - Jirka KosekInitial support of syntax highlighting of programlistings.M: /trunk/xsl/html/param.ent; M: /trunk/xsl/html/param.xweb; A: /trunk/xsl/html/highlight.xsl; M: /trunk/xsl/html/verbatim.xsl - Jirka KosekSupport orgM: /trunk/xsl/html/info.xsl - Norman WalshSupport personM: /trunk/xsl/html/inline.xsl - Norman WalshSupport $keep.relative.image.uris also when chunkingM: /trunk/xsl/html/chunk-code.xsl - Jirka KosekHighlightingThe following changes have been made to the
highlighting code
since the 1.70.1 release.Initial support of syntax highlighting of programlistings.A: /trunk/xsl/highlighting/php-hl.xml; A: /trunk/xsl/highlighting/common.xsl; A: /trunk/xsl/highlighting/delphi-hl.xml; A: /trunk/xsl/highlighting/myxml-hl.xml; A: /trunk/xsl/highlighting/m2-hl.xml; A: /trunk/xsl/highlighting/ini-hl.xml; A: /trunk/xsl/highlighting/xslthl-config.xml; A: /trunk/xsl/highlighting/java-hl.xml - Jirka KosekManpagesThe following changes have been made to the
manpages code
since the 1.70.1 release.Suppress footnote markers and output warning that footnotes are
not yet supported.M: /trunk/xsl/manpages/docbook.xsl; M: /trunk/xsl/manpages/links.xsl; M: /trunk/xsl/manpages/other.xsl - Michael(tm) SmithHandle instances of address/otheraddr/ulink in author et al in the
same way as email instances; that is, display them on the same
linke as the author, editor, etc., name.M: /trunk/xsl/manpages/info.xsl - Michael(tm) SmithDon't number or link-list any Ulink instance whose string value is
identical to the value of its url attribute. Just display it inline.M: /trunk/xsl/manpages/links.xsl - Michael(tm) SmithDon't output punctuation between Refname and Refpurpose if
Refpurpose is empty. Also corrected handling of Refsect2/title
instances, and removed some debugging stuff that was generated in
manpages output to mark the ends of sections.M: /trunk/xsl/manpages/refentry.xsl - Michael(tm) SmithAdded new email.delimiters.enabled param. If non-zero (the
default), delimiters are generated around e-mail addresses (output
of the email element). If zero, the delimiters are suppressed.M: /trunk/xsl/manpages/param.xweb; M: /trunk/xsl/manpages/param.ent - Michael(tm) SmithIn manpages output, if the last/nearest *info element for
particular Refentry has multiple Copyright and/or Legalnotice
children, process them all (not just the first ones). Closes bug
1524576. Thanks to Sam Steingold for the report and to Daniel
Leidert for providing a patch.M: /trunk/xsl/manpages/info.xsl - Michael(tm) SmithParamsThe following changes have been made to the
params code
since the 1.70.1 release.Added reference.autolabel parameter for controlling labels on
reference output.A: /trunk/xsl/params/reference.autolabel.xml - Michael(tm) SmithAdded namespace declarations to document elements for all param files.M: /trunk/xsl/params/toc.line.properties.xml; M: /trunk/xsl/params/title.font.family.xml; M: /trunk/xsl/params/component.label.includes.part.label.xml; M: /trunk/xsl/params/refentry.manual.profile.xml; M: /trunk/xsl/params/orderedlist.properties.xml; M: /trunk/xsl/params/olink.pubid.xml; M: /trunk/xsl/params/informalexample.properties.xml; M: /trunk/xsl/params/appendix.autolabel.xml; M: /trunk/xsl/params/htmlhelp.show.toolbar.text.xml; M: /trunk/xsl/params/index.on.role.xml; M: /trunk/xsl/params/htmlhelp.button.jump2.url.xml; M: /trunk/xsl/params/variablelist.term.separator.xml; M: /trunk/xsl/params/para.propagates.style.xml; M: /trunk/xsl/params/html.stylesheet.xml; M: /trunk/xsl/params/qanda.nested.in.toc.xml; M: /trunk/xsl/params/annotation.css.xml; M: /trunk/xsl/params/funcsynopsis.style.xml; M: /trunk/xsl/params/htmlhelp.encoding.xml; M: /trunk/xsl/params/footer.content.properties.xml; M: /trunk/xsl/params/verbatim.properties.xml; M: /trunk/xsl/params/autotoc.label.in.hyperlink.xml; M: /trunk/xsl/params/body.margin.top.xml; M: /trunk/xsl/params/bibliography.numbered.xml; M: /trunk/xsl/params/figure.properties.xml; M: /trunk/xsl/params/variablelist.max.termlength.xml; M: /trunk/xsl/params/table.cell.border.style.xml; M: /trunk/xsl/params/htmlhelp.button.options.xml; M: /trunk/xsl/params/preferred.mediaobject.role.xml; M: /trunk/xsl/params/htmlhelp.chm.xml; M: /trunk/xsl/params/man.charmap.subset.profile.xml; M: /trunk/xsl/params/qanda.title.level3.properties.xml; M: /trunk/xsl/params/page.width.xml; M: /trunk/xsl/params/firstterm.only.link.xml; M: /trunk/xsl/params/section.level6.properties.xml; M: /trunk/xsl/params/htmlhelp.button.locate.xml; M: /trunk/xsl/params/chunk.sections.xml; M: /trunk/xsl/params/use.local.olink.style.xml; M: /trunk/xsl/params/refentry.date.profile.enabled.xml; M: /trunk/xsl/params/refentry.version.suppress.xml; M: /trunk/xsl/params/refentry.generate.title.xml; M: /trunk/xsl/params/punct.honorific.xml; M: /trunk/xsl/params/column.gap.index.xml; M: /trunk/xsl/params/body.start.indent.xml; M: /trunk/xsl/params/crop.mark.width.xml; M: /trunk/xsl/params/refentry.version.profile.enabled.xml; M: /trunk/xsl/params/superscript.properties.xml; M: /trunk/xsl/params/chunker.output.doctype-public.xml; M: /trunk/xsl/params/saxon.character.representation.xml; M: /trunk/xsl/params/saxon.linenumbering.xml; M: /trunk/xsl/params/shade.verbatim.style.xml; M: /trunk/xsl/params/annotate.toc.xml; M: /trunk/xsl/params/profile.attribute.xml; M: /trunk/xsl/params/callout.graphics.number.limit.xml; M: /trunk/xsl/params/profile.arch.xml; M: /trunk/xsl/params/saxon.tablecolumns.xml; M: /trunk/xsl/params/glossterm.auto.link.xml; M: /trunk/xsl/params/default.units.xml; M: /trunk/xsl/params/qanda.title.level1.properties.xml; M: /trunk/xsl/params/list.block.spacing.xml; M: /trunk/xsl/params/section.level4.properties.xml; M: /trunk/xsl/params/spacing.paras.xml; M: /trunk/xsl/params/column.count.index.xml; M: /trunk/xsl/params/dingbat.font.family.xml; M: /trunk/xsl/params/citerefentry.link.xml; M: /trunk/xsl/params/keep.relative.image.uris.xml; M: /trunk/xsl/params/ulink.footnotes.xml; M: /trunk/xsl/params/prefer.internal.olink.xml; M: /trunk/xsl/params/refentry.title.properties.xml; M: /trunk/xsl/params/variablelist.term.break.after.xml; M: /trunk/xsl/params/use.id.function.xml; M: /trunk/xsl/params/callout.unicode.start.character.xml; M: /trunk/xsl/params/column.gap.titlepage.xml; M: /trunk/xsl/params/editedby.enabled.xml; M: /trunk/xsl/params/funcsynopsis.tabular.threshold.xml; M: /trunk/xsl/params/use.extensions.xml; M: /trunk/xsl/params/index.preferred.page.properties.xml; M: /trunk/xsl/params/man.th.extra3.max.length.xml; M: /trunk/xsl/params/column.gap.back.xml; M: /trunk/xsl/params/tex.math.delims.xml; M: /trunk/xsl/params/article.appendix.title.properties.xml; M: /trunk/xsl/params/ulink.target.xml; M: /trunk/xsl/params/suppress.header.navigation.xml; M: /trunk/xsl/params/olink.resolver.xml; M: /trunk/xsl/params/admon.textlabel.xml; M: /trunk/xsl/params/procedure.properties.xml; M: /trunk/xsl/params/blurb.on.titlepage.enabled.xml; M: /trunk/xsl/params/section.level2.properties.xml; M: /trunk/xsl/params/column.gap.front.xml; M: /trunk/xsl/params/margin.note.title.properties.xml; M: /trunk/xsl/params/glossary.collection.xml; M: /trunk/xsl/params/admon.graphics.xml; M: /trunk/xsl/params/current.docid.xml; M: /trunk/xsl/params/qanda.inherit.numeration.xml; M: /trunk/xsl/params/table.cell.padding.xml; M: /trunk/xsl/params/preface.autolabel.xml; M: /trunk/xsl/params/man.th.extra3.suppress.xml; M: /trunk/xsl/params/wordml.template.xml; M: /trunk/xsl/params/htmlhelp.use.hhk.xml; M: /trunk/xsl/params/textinsert.extension.xml; M: /trunk/xsl/params/ebnf.table.bgcolor.xml; M: /trunk/xsl/params/refentry.source.fallback.profile.xml; M: /trunk/xsl/params/body.font.master.xml; M: /trunk/xsl/params/l10n.gentext.default.language.xml; M: /trunk/xsl/params/list.block.properties.xml; M: /trunk/xsl/params/refentry.source.name.suppress.xml; M: /trunk/xsl/params/htmlhelp.hhp.window.xml; M: /trunk/xsl/params/sidebar.properties.xml; M: /trunk/xsl/params/tex.math.file.xml; M: /trunk/xsl/params/man.justify.xml; M: /trunk/xsl/params/subscript.properties.xml; M: /trunk/xsl/params/column.count.front.xml; M: /trunk/xsl/params/index.term.separator.xml; M: /trunk/xsl/params/biblioentry.properties.xml; M: /trunk/xsl/params/biblioentry.item.separator.xml; M: /trunk/xsl/params/htmlhelp.button.home.url.xml; M: /trunk/xsl/params/column.count.body.xml; M: /trunk/xsl/params/suppress.navigation.xml; M: /trunk/xsl/params/htmlhelp.remember.window.position.xml; M: /trunk/xsl/params/htmlhelp.hhc.section.depth.xml; M: /trunk/xsl/params/xref.with.number.and.title.xml; M: /trunk/xsl/params/make.year.ranges.xml; M: /trunk/xsl/params/region.before.extent.xml; M: /trunk/xsl/params/xref.label-page.separator.xml; M: /trunk/xsl/params/html.longdesc.link.xml; M: /trunk/xsl/params/man.subheading.divider.enabled.xml; M: /trunk/xsl/params/index.entry.properties.xml; M: /trunk/xsl/params/generate.legalnotice.link.xml; M: /trunk/xsl/params/section.autolabel.xml; M: /trunk/xsl/params/html.base.xml; M: /trunk/xsl/params/suppress.footer.navigation.xml; M: /trunk/xsl/params/nominal.image.depth.xml; M: /trunk/xsl/params/table.footnote.number.symbols.xml; M: /trunk/xsl/params/table.footnote.number.format.xml; M: /trunk/xsl/params/callout.graphics.xml; M: /trunk/xsl/params/man.break.after.slash.xml; M: /trunk/xsl/params/function.parens.xml; M: /trunk/xsl/params/part.autolabel.xml; M: /trunk/xsl/params/saxon.callouts.xml; M: /trunk/xsl/params/css.decoration.xml; M: /trunk/xsl/params/htmlhelp.button.home.xml; M: /trunk/xsl/params/email.delimiters.enabled.xml; M: /trunk/xsl/params/column.count.lot.xml; M: /trunk/xsl/params/draft.mode.xml; M: /trunk/xsl/params/use.role.for.mediaobject.xml; M: /trunk/xsl/params/refentry.separator.xml; M: /trunk/xsl/params/man.font.funcsynopsisinfo.xml; M: /trunk/xsl/params/man.output.manifest.filename.xml; M: /trunk/xsl/params/process.empty.source.toc.xml; M: /trunk/xsl/params/man.output.in.separate.dir.xml; M: /trunk/xsl/params/graphicsize.use.img.src.path.xml; M: /trunk/xsl/params/man.output.encoding.xml; M: /trunk/xsl/params/column.gap.lot.xml; M: /trunk/xsl/params/profile.role.xml; M: /trunk/xsl/params/column.count.titlepage.xml; M: /trunk/xsl/params/show.comments.xml; M: /trunk/xsl/params/informalfigure.properties.xml; M: /trunk/xsl/params/entry.propagates.style.xml; M: /trunk/xsl/params/bibliography.collection.xml; M: /trunk/xsl/params/contrib.inline.enabled.xml; M: /trunk/xsl/params/section.title.level5.properties.xml; M: /trunk/xsl/params/fop.extensions.xml; M: /trunk/xsl/params/htmlhelp.button.jump1.xml; M: /trunk/xsl/params/man.hyphenate.urls.xml; M: /trunk/xsl/params/profile.condition.xml; M: /trunk/xsl/params/header.column.widths.xml; M: /trunk/xsl/params/annotation.js.xml; M: /trunk/xsl/params/chunker.output.standalone.xml; M: /trunk/xsl/params/targets.filename.xml; M: /trunk/xsl/params/default.float.class.xml; M: /trunk/xsl/params/chapter.autolabel.xml; M: /trunk/xsl/params/sidebar.float.type.xml; M: /trunk/xsl/params/profile.separator.xml; M: /trunk/xsl/params/generate.index.xml; M: /trunk/xsl/params/nongraphical.admonition.properties.xml; M: /trunk/xsl/params/navig.graphics.xml; M: /trunk/xsl/params/htmlhelp.button.next.xml; M: /trunk/xsl/params/insert.olink.pdf.frag.xml; M: /trunk/xsl/params/htmlhelp.button.stop.xml; M: /trunk/xsl/params/footnote.font.size.xml; M: /trunk/xsl/params/profile.value.xml; M: /trunk/xsl/params/ebnf.table.border.xml; M: /trunk/xsl/params/htmlhelp.hhc.folders.instead.books.xml; M: /trunk/xsl/params/glossary.as.blocks.xml; M: /trunk/xsl/params/body.end.indent.xml; M: /trunk/xsl/params/use.role.as.xrefstyle.xml; M: /trunk/xsl/params/man.indent.blurbs.xml; M: /trunk/xsl/params/chunker.output.encoding.xml; M: /trunk/xsl/params/chunker.output.omit-xml-declaration.xml; M: /trunk/xsl/params/sans.font.family.xml; M: /trunk/xsl/params/html.cleanup.xml; M: /trunk/xsl/params/htmlhelp.hhp.xml; M: /trunk/xsl/params/htmlhelp.only.xml; M: /trunk/xsl/params/eclipse.plugin.name.xml; M: /trunk/xsl/params/section.title.level3.properties.xml; M: /trunk/xsl/params/man.th.extra1.suppress.xml; M: /trunk/xsl/params/chunk.section.depth.xml; M: /trunk/xsl/params/htmlhelp.hhp.tail.xml; M: /trunk/xsl/params/sidebar.title.properties.xml; M: /trunk/xsl/params/hyphenate.xml; M: /trunk/xsl/params/paper.type.xml; M: /trunk/xsl/params/chunk.tocs.and.lots.has.title.xml; M: /trunk/xsl/params/symbol.font.family.xml; M: /trunk/xsl/params/page.margin.bottom.xml; M: /trunk/xsl/params/callout.unicode.number.limit.xml; M: /trunk/xsl/params/itemizedlist.properties.xml; M: /trunk/xsl/params/root.filename.xml; M: /trunk/xsl/params/tablecolumns.extension.xml; M: /trunk/xsl/params/htmlhelp.show.favorities.xml; M: /trunk/xsl/params/informaltable.properties.xml; M: /trunk/xsl/params/revhistory.table.cell.properties.xml; M: /trunk/xsl/params/htmlhelp.default.topic.xml; M: /trunk/xsl/params/compact.list.item.spacing.xml; M: /trunk/xsl/params/page.height.portrait.xml; M: /trunk/xsl/params/html.head.legalnotice.link.types.xml; M: /trunk/xsl/params/passivetex.extensions.xml; M: /trunk/xsl/params/orderedlist.label.properties.xml; M: /trunk/xsl/params/othercredit.like.author.enabled.xml; M: /trunk/xsl/params/header.content.properties.xml; M: /trunk/xsl/params/refentry.meta.get.quietly.xml; M: /trunk/xsl/params/section.properties.xml; M: /trunk/xsl/params/htmlhelp.button.hideshow.xml; M: /trunk/xsl/params/simplesect.in.toc.xml; M: /trunk/xsl/params/chunk.quietly.xml; M: /trunk/xsl/params/htmlhelp.enumerate.images.xml; M: /trunk/xsl/params/section.title.level1.properties.xml; M: /trunk/xsl/params/qanda.defaultlabel.xml; M: /trunk/xsl/params/htmlhelp.enhanced.decompilation.xml; M: /trunk/xsl/params/man.th.title.max.length.xml; M: /trunk/xsl/params/footnote.number.format.xml; M: /trunk/xsl/params/body.margin.bottom.xml; M: /trunk/xsl/params/htmlhelp.window.geometry.xml; M: /trunk/xsl/params/htmlhelp.button.jump2.xml; M: /trunk/xsl/params/use.svg.xml; M: /trunk/xsl/params/qanda.title.level6.properties.xml; M: /trunk/xsl/params/collect.xref.targets.xml; M: /trunk/xsl/params/html.extra.head.links.xml; M: /trunk/xsl/params/variablelist.as.table.xml; M: /trunk/xsl/params/man.indent.width.xml; M: /trunk/xsl/params/eclipse.plugin.id.xml; M: /trunk/xsl/params/linenumbering.width.xml; M: /trunk/xsl/params/axf.extensions.xml; M: /trunk/xsl/params/menuchoice.separator.xml; M: /trunk/xsl/params/glossterm.separation.xml; M: /trunk/xsl/params/htmlhelp.autolabel.xml; M: /trunk/xsl/params/chunk.separate.lots.xml; M: /trunk/xsl/params/man.hyphenate.computer.inlines.xml; M: /trunk/xsl/params/linenumbering.separator.xml; M: /trunk/xsl/params/htmlhelp.title.xml; M: /trunk/xsl/params/index.number.separator.xml; M: /trunk/xsl/params/htmlhelp.button.prev.xml; M: /trunk/xsl/params/refentry.manual.fallback.profile.xml; M: /trunk/xsl/params/table.frame.border.color.xml; M: /trunk/xsl/params/footnote.sep.leader.properties.xml; M: /trunk/xsl/params/hyphenate.verbatim.characters.xml; M: /trunk/xsl/params/table.cell.border.thickness.xml; M: /trunk/xsl/params/template.xml; M: /trunk/xsl/params/margin.note.properties.xml; M: /trunk/xsl/params/man.segtitle.suppress.xml; M: /trunk/xsl/params/generate.toc.xml; M: /trunk/xsl/params/formal.object.properties.xml; M: /trunk/xsl/params/footnote.mark.properties.xml; M: /trunk/xsl/params/header.table.height.xml; M: /trunk/xsl/params/htmlhelp.button.back.xml; M: /trunk/xsl/params/qanda.title.level4.properties.xml; M: /trunk/xsl/params/man.links.are.numbered.xml; M: /trunk/xsl/params/manual.toc.xml; M: /trunk/xsl/params/olink.lang.fallback.sequence.xml; M: /trunk/xsl/params/refentry.manual.profile.enabled.xml; M: /trunk/xsl/params/ulink.hyphenate.chars.xml; M: /trunk/xsl/params/manifest.xml; M: /trunk/xsl/params/olink.fragid.xml; M: /trunk/xsl/params/refentry.date.profile.xml; M: /trunk/xsl/params/linenumbering.extension.xml; M: /trunk/xsl/params/component.title.properties.xml; M: /trunk/xsl/params/alignment.xml; M: /trunk/xsl/params/refentry.version.profile.xml; M: /trunk/xsl/params/ebnf.assignment.xml; M: /trunk/xsl/params/htmlhelp.button.print.xml; M: /trunk/xsl/params/annotation.support.xml; M: /trunk/xsl/params/sidebar.float.width.xml; M: /trunk/xsl/params/normal.para.spacing.xml; M: /trunk/xsl/params/xref.title-page.separator.xml; M: /trunk/xsl/params/callout.unicode.font.xml; M: /trunk/xsl/params/default.table.frame.xml; M: /trunk/xsl/params/pages.template.xml; M: /trunk/xsl/params/htmlhelp.button.zoom.xml; M: /trunk/xsl/params/admonition.title.properties.xml; M: /trunk/xsl/params/callout.graphics.extension.xml; M: /trunk/xsl/params/make.valid.html.xml; M: /trunk/xsl/params/qanda.title.level2.properties.xml; M: /trunk/xsl/params/page.margin.top.xml; M: /trunk/xsl/params/xep.index.item.properties.xml; M: /trunk/xsl/params/section.level5.properties.xml; M: /trunk/xsl/params/line-height.xml; M: /trunk/xsl/params/table.cell.border.color.xml; M: /trunk/xsl/params/qandadiv.autolabel.xml; M: /trunk/xsl/params/xref.label-title.separator.xml; M: /trunk/xsl/params/chunk.tocs.and.lots.xml; M: /trunk/xsl/params/man.font.funcprototype.xml; M: /trunk/xsl/params/process.source.toc.xml; M: /trunk/xsl/params/page.orientation.xml; M: /trunk/xsl/params/refentry.generate.name.xml; M: /trunk/xsl/params/navig.showtitles.xml; M: /trunk/xsl/params/table.table.properties.xml; M: /trunk/xsl/params/arbortext.extensions.xml; M: /trunk/xsl/params/informalequation.properties.xml; M: /trunk/xsl/params/headers.on.blank.pages.xml; M: /trunk/xsl/params/table.footnote.properties.xml; M: /trunk/xsl/params/root.properties.xml; M: /trunk/xsl/params/htmlhelp.display.progress.xml; M: /trunk/xsl/params/htmlhelp.hhp.windows.xml; M: /trunk/xsl/params/graphical.admonition.properties.xml; M: /trunk/xsl/params/refclass.suppress.xml; M: /trunk/xsl/params/profile.conformance.xml; M: /trunk/xsl/params/htmlhelp.button.forward.xml; M: /trunk/xsl/params/segmentedlist.as.table.xml; M: /trunk/xsl/params/margin.note.float.type.xml; M: /trunk/xsl/params/man.table.footnotes.divider.xml; M: /trunk/xsl/params/man.output.quietly.xml; M: /trunk/xsl/params/htmlhelp.hhc.show.root.xml; M: /trunk/xsl/params/footers.on.blank.pages.xml; M: /trunk/xsl/params/crop.mark.offset.xml; M: /trunk/xsl/params/olink.doctitle.xml; M: /trunk/xsl/params/section.level3.properties.xml; M: /trunk/xsl/params/callout.unicode.xml; M: /trunk/xsl/params/formal.procedures.xml; M: /trunk/xsl/params/toc.section.depth.xml; M: /trunk/xsl/params/index.prefer.titleabbrev.xml; M: /trunk/xsl/params/nominal.image.width.xml; M: /trunk/xsl/params/htmlhelp.show.menu.xml; M: /trunk/xsl/params/linenumbering.everyNth.xml; M: /trunk/xsl/params/double.sided.xml; M: /trunk/xsl/params/generate.revhistory.link.xml; M: /trunk/xsl/params/olink.properties.xml; M: /trunk/xsl/params/tex.math.in.alt.xml; M: /trunk/xsl/params/man.output.subdirs.enabled.xml; M: /trunk/xsl/params/section.title.properties.xml; M: /trunk/xsl/params/column.count.back.xml; M: /trunk/xsl/params/toc.indent.width.xml; M: /trunk/xsl/params/man.charmap.uri.xml; M: /trunk/xsl/params/index.method.xml; M: /trunk/xsl/params/generate.section.toc.level.xml; M: /trunk/xsl/params/page.width.portrait.xml; M: /trunk/xsl/params/man.th.extra2.max.length.xml; M: /trunk/xsl/params/abstract.properties.xml; M: /trunk/xsl/params/revhistory.table.properties.xml; M: /trunk/xsl/params/nominal.table.width.xml; M: /trunk/xsl/params/ulink.show.xml; M: /trunk/xsl/params/htmlhelp.button.jump1.title.xml; M: /trunk/xsl/params/index.div.title.properties.xml; M: /trunk/xsl/params/profile.userlevel.xml; M: /trunk/xsl/params/html.cellpadding.xml; M: /trunk/xsl/params/orderedlist.label.width.xml; M: /trunk/xsl/params/crop.marks.xml; M: /trunk/xsl/params/menuchoice.menu.separator.xml; M: /trunk/xsl/params/author.othername.in.middle.xml; M: /trunk/xsl/params/section.level1.properties.xml; M: /trunk/xsl/params/textdata.default.encoding.xml; M: /trunk/xsl/params/label.from.part.xml; M: /trunk/xsl/params/use.embed.for.svg.xml; M: /trunk/xsl/params/list.item.spacing.xml; M: /trunk/xsl/params/htmlhelp.hhc.width.xml; M: /trunk/xsl/params/column.gap.body.xml; M: /trunk/xsl/params/rootid.xml; M: /trunk/xsl/params/glosslist.as.blocks.xml; M: /trunk/xsl/params/index.range.separator.xml; M: /trunk/xsl/params/html.ext.xml; M: /trunk/xsl/params/callout.list.table.xml; M: /trunk/xsl/params/highlight.source.xml; M: /trunk/xsl/params/show.revisionflag.xml; M: /trunk/xsl/params/man.output.manifest.enabled.xml; M: /trunk/xsl/params/make.single.year.ranges.xml; M: /trunk/xsl/params/pgwide.properties.xml; M: /trunk/xsl/params/generate.id.attributes.xml; M: /trunk/xsl/params/emphasis.propagates.style.xml; M: /trunk/xsl/params/abstract.title.properties.xml; M: /trunk/xsl/params/htmlhelp.hhc.xml; M: /trunk/xsl/params/monospace.properties.xml; M: /trunk/xsl/params/htmlhelp.hhk.xml; M: /trunk/xsl/params/table.borders.with.css.xml; M: /trunk/xsl/params/man.links.are.underlined.xml; M: /trunk/xsl/params/profile.vendor.xml; M: /trunk/xsl/params/shade.verbatim.xml; M: /trunk/xsl/params/callout.graphics.path.xml; M: /trunk/xsl/params/olink.debug.xml; M: /trunk/xsl/params/make.graphic.viewport.xml; M: /trunk/xsl/params/footnote.number.symbols.xml; M: /trunk/xsl/params/man.charmap.enabled.xml; M: /trunk/xsl/params/page.height.xml; M: /trunk/xsl/params/htmlhelp.button.jump1.url.xml; M: /trunk/xsl/params/man.font.table.title.xml; M: /trunk/xsl/params/revhistory.title.properties.xml; M: /trunk/xsl/params/chunker.output.media-type.xml; M: /trunk/xsl/params/glossterm.width.xml; M: /trunk/xsl/params/points.per.em.xml; M: /trunk/xsl/params/page.margin.inner.xml; M: /trunk/xsl/params/itemizedlist.label.width.xml; M: /trunk/xsl/params/ulink.hyphenate.xml; M: /trunk/xsl/params/crop.mark.bleed.xml; M: /trunk/xsl/params/use.id.as.filename.xml; M: /trunk/xsl/params/section.title.level6.properties.xml; M: /trunk/xsl/params/highlight.default.language.xml; M: /trunk/xsl/params/man.th.extra2.suppress.xml; M: /trunk/xsl/params/id.warnings.xml; M: /trunk/xsl/params/title.margin.left.xml; M: /trunk/xsl/params/chunker.output.doctype-system.xml; M: /trunk/xsl/params/man.indent.verbatims.xml; M: /trunk/xsl/params/table.frame.border.thickness.xml; M: /trunk/xsl/params/monospace.verbatim.properties.xml; M: /trunk/xsl/params/formal.title.properties.xml; M: /trunk/xsl/params/margin.note.width.xml; M: /trunk/xsl/params/man.hyphenate.filenames.xml; M: /trunk/xsl/params/blockquote.properties.xml; M: /trunk/xsl/params/callout.defaultcolumn.xml; M: /trunk/xsl/params/profile.security.xml; M: /trunk/xsl/params/informal.object.properties.xml; M: /trunk/xsl/params/formal.title.placement.xml; M: /trunk/xsl/params/draft.watermark.image.xml; M: /trunk/xsl/params/equation.properties.xml; M: /trunk/xsl/params/body.font.family.xml; M: /trunk/xsl/params/ignore.image.scaling.xml; M: /trunk/xsl/params/chunk.first.sections.xml; M: /trunk/xsl/params/base.dir.xml; M: /trunk/xsl/params/footnote.properties.xml; M: /trunk/xsl/params/olink.outline.ext.xml; M: /trunk/xsl/params/img.src.path.xml; M: /trunk/xsl/params/qanda.title.properties.xml; M: /trunk/xsl/params/ebnf.statement.terminator.xml; M: /trunk/xsl/params/callouts.extension.xml; M: /trunk/xsl/params/manifest.in.base.dir.xml; M: /trunk/xsl/params/fop1.extensions.xml; M: /trunk/xsl/params/olink.sysid.xml; M: /trunk/xsl/params/section.title.level4.properties.xml; M: /trunk/xsl/params/monospace.font.family.xml; M: /trunk/xsl/params/l10n.gentext.language.xml; M: /trunk/xsl/params/graphic.default.extension.xml; M: /trunk/xsl/params/default.image.width.xml; M: /trunk/xsl/params/htmlhelp.button.refresh.xml; M: /trunk/xsl/params/chunker.output.cdata-section-elements.xml; M: /trunk/xsl/params/admon.graphics.path.xml; M: /trunk/xsl/params/admon.style.xml; M: /trunk/xsl/params/profile.revision.xml; M: /trunk/xsl/params/generate.manifest.xml; M: /trunk/xsl/params/html.longdesc.xml; M: /trunk/xsl/params/footer.rule.xml; M: /trunk/xsl/params/eclipse.plugin.provider.xml; M: /trunk/xsl/params/refentry.source.name.profile.xml; M: /trunk/xsl/params/toc.max.depth.xml; M: /trunk/xsl/params/chunker.output.indent.xml; M: /trunk/xsl/params/html.head.legalnotice.link.multiple.xml; M: /trunk/xsl/params/toc.list.type.xml; M: /trunk/xsl/params/link.mailto.url.xml; M: /trunk/xsl/params/table.properties.xml; M: /trunk/xsl/params/side.float.properties.xml; M: /trunk/xsl/params/man.charmap.use.subset.xml; M: /trunk/xsl/params/annotation.graphic.open.xml; M: /trunk/xsl/params/html.cellspacing.xml; M: /trunk/xsl/params/default.table.width.xml; M: /trunk/xsl/params/xep.extensions.xml; M: /trunk/xsl/params/admonition.properties.xml; M: /trunk/xsl/params/toc.margin.properties.xml; M: /trunk/xsl/params/chunk.toc.xml; M: /trunk/xsl/params/table.entry.padding.xml; M: /trunk/xsl/params/header.rule.xml; M: /trunk/xsl/params/glossentry.show.acronym.xml; M: /trunk/xsl/params/variablelist.as.blocks.xml; M: /trunk/xsl/params/man.hyphenate.xml; M: /trunk/xsl/params/refentry.source.name.profile.enabled.xml; M: /trunk/xsl/params/section.label.includes.component.label.xml; M: /trunk/xsl/params/bridgehead.in.toc.xml; M: /trunk/xsl/params/section.title.level2.properties.xml; M: /trunk/xsl/params/admon.graphics.extension.xml; M: /trunk/xsl/params/inherit.keywords.xml; M: /trunk/xsl/params/insert.xref.page.number.xml; M: /trunk/xsl/params/pixels.per.inch.xml; M: /trunk/xsl/params/refentry.pagebreak.xml; M: /trunk/xsl/params/profile.lang.xml; M: /trunk/xsl/params/insert.olink.page.number.xml; M: /trunk/xsl/params/generate.meta.abstract.xml; M: /trunk/xsl/params/graphicsize.extension.xml; M: /trunk/xsl/params/man.indent.lists.xml; M: /trunk/xsl/params/funcsynopsis.decoration.xml; M: /trunk/xsl/params/runinhead.title.end.punct.xml; M: /trunk/xsl/params/man.string.subst.map.xml; M: /trunk/xsl/params/man.links.list.enabled.xml; M: /trunk/xsl/params/section.autolabel.max.depth.xml; M: /trunk/xsl/params/htmlhelp.show.advanced.search.xml; M: /trunk/xsl/params/htmlhelp.map.file.xml; M: /trunk/xsl/params/l10n.gentext.use.xref.language.xml; M: /trunk/xsl/params/body.font.size.xml; M: /trunk/xsl/params/html.stylesheet.type.xml; M: /trunk/xsl/params/refentry.xref.manvolnum.xml; M: /trunk/xsl/params/runinhead.default.title.end.punct.xml; M: /trunk/xsl/params/navig.graphics.extension.xml; M: /trunk/xsl/params/itemizedlist.label.properties.xml; M: /trunk/xsl/params/htmlhelp.force.map.and.alias.xml; M: /trunk/xsl/params/profile.os.xml; M: /trunk/xsl/params/htmlhelp.alias.file.xml; M: /trunk/xsl/params/page.margin.outer.xml; M: /trunk/xsl/params/annotation.graphic.close.xml; M: /trunk/xsl/params/eclipse.autolabel.xml; M: /trunk/xsl/params/table.frame.border.style.xml; M: /trunk/xsl/params/navig.graphics.path.xml; M: /trunk/xsl/params/htmlhelp.hhc.binary.xml; M: /trunk/xsl/params/index.on.type.xml; M: /trunk/xsl/params/target.database.document.xml; M: /trunk/xsl/params/man.subheading.divider.xml; M: /trunk/xsl/params/chunker.output.method.xml; M: /trunk/xsl/params/make.index.markup.xml; M: /trunk/xsl/params/olink.base.uri.xml; M: /trunk/xsl/params/phrase.propagates.style.xml; M: /trunk/xsl/params/man.indent.refsect.xml; M: /trunk/xsl/params/example.properties.xml; M: /trunk/xsl/params/man.font.table.headings.xml; M: /trunk/xsl/params/profile.revisionflag.xml; M: /trunk/xsl/params/region.after.extent.xml; M: /trunk/xsl/params/qanda.title.level5.properties.xml; M: /trunk/xsl/params/marker.section.level.xml; M: /trunk/xsl/params/footer.table.height.xml; M: /trunk/xsl/params/autotoc.label.separator.xml; M: /trunk/xsl/params/footer.column.widths.xml; M: /trunk/xsl/params/hyphenate.verbatim.xml; M: /trunk/xsl/params/xref.properties.xml; M: /trunk/xsl/params/man.output.base.dir.xml; M: /trunk/xsl/params/man.links.list.heading.xml; M: /trunk/xsl/params/insert.link.page.number.xml; M: /trunk/xsl/params/htmlhelp.button.jump2.title.xml; M: /trunk/xsl/params/l10n.lang.value.rfc.compliant.xml - Michael(tm) SmithUpdated index.method doc to describe revised setup for importing index extensions.M: /trunk/xsl/params/index.method.xml - Robert StaytonAdded several new HTML parameters for controlling appearance of
content on HTML title pages:
contrib.inline.enabled:
If non-zero (the default), output of the contrib element is
displayed as inline content rather than as block content.
othercredit.like.author.enabled:
If non-zero, output of the othercredit element on titlepages is
displayed in the same style as author and editor output. If zero
(the default), othercredit output is displayed using a style
different than that of author and editor.
blurb.on.titlepage.enabled:
If non-zero, output from authorblurb and personblurb elements is
displayed on title pages. If zero (the default), output from
those elements is suppressed on title pages (unless you are
using a titlepage customization that causes them to be included).
editedby.enabled
If non-zero (the default), a localized Edited by heading is
displayed above editor names in output of the editor element.A: /trunk/xsl/params/contrib.inline.enabled.xml; A: /trunk/xsl/params/blurb.on.titlepage.enabled.xml; A: /trunk/xsl/params/othercredit.like.author.enabled.xml; A: /trunk/xsl/params/editedby.enabled.xml - Michael(tm) SmithAdded new email.delimiters.enabled param. If non-zero (the
default), delimiters are generated around e-mail addresses (output
of the email element). If zero, the delimiters are suppressed.A: /trunk/xsl/params/email.delimiters.enabled.xml - Michael(tm) SmithAdded qanda.nested.in.toc param. Default value is zero. If
non-zero, instances of "nested" Qandaentry (ones that are children
of Answer elements) are displayed in the TOC. Closes patch 1509018
(from Daniel Leidert). Currently on affects HTML output (no patch
for FO output provided).A: /trunk/xsl/params/qanda.nested.in.toc.xml - Michael(tm) SmithInitial support of syntax highlighting of programlistings.A: /trunk/xsl/params/highlight.source.xml; A: /trunk/xsl/params/highlight.default.language.xml - Jirka KosekToolsThe following changes have been made to the
tools code
since the 1.70.1 release.Racheted down font sizes of headings in example makefile FO output.M: /trunk/xsl/tools/make/Makefile.DocBook - Michael(tm) SmithAdded param and attribute set to example makefile, for getting
wrapping in verbatims in FO output.M: /trunk/xsl/tools/make/Makefile.DocBook - Michael(tm) SmithRenamed Makefile.paramDoc to Makefile.docParam.A: /trunk/xsl/tools/make/Makefile.docParam; D: /trunk/xsl/tools/make/Makefile.paramDoc - Michael(tm) SmithAdded Makefile.paramDoc file, for creating versions of param.xsl
files with doc embedded.A: /trunk/xsl/tools/make/Makefile.paramDoc - Michael(tm) SmithAdded variable to example makefile for controlling whether HTML or
XHTML is generated.M: /trunk/xsl/tools/make/Makefile.DocBook - Michael(tm) SmithRelease: 1.70.1This is a stable release of the 1.70 stylesheets. It includes only a
few small changes from 1.70.0.The following is a list of changes that have been made
since the 1.70.0 release.FOThe following changes have been made to the
fo code
since the 1.70.0 release.Added three new attribute sets (revhistory.title.properties, revhistory.table.properties and revhistory.table.cell.properties) for controlling appearance of revhistory in FO output.Modified: fo/block.xsl,1.34; fo/param.ent,1.101; fo/param.xweb,1.114; fo/titlepage.xsl,1.41; params/revhistory.table.cell.properties.xml,1.1; params/revhistory.table.properties.xml,1.1; params/revhistory.title.properties.xml,1.1 - Jirka KosekSupport DBv5 revisions with full author name (not only authorinitials)Modified: fo/block.xsl,1.33; fo/titlepage.xsl,1.40 - Jirka KosekHTMLThe following changes have been made to the
html code
since the 1.70.0 release.Support DBv5 revisions with full author name (not only authorinitials)Modified: html/block.xsl,1.23; html/titlepage.xsl,1.34 - Jirka KosekHTMLHelpThe following changes have been made to the
htmlhelp code
since the 1.70.0 release.htmlhelp.generate.index is now param, not variable. This means that you can override its setting from outside. This is useful when you generate indexterms on the fly (see http://www.xml.com/pub/a/2004/07/14/dbndx.html?page=3).Modified: htmlhelp/htmlhelp-common.xsl,1.38 - Jirka KosekSupport chunk.tocs.and.lots in HTML HelpModified: htmlhelp/htmlhelp-common.xsl,1.37 - Jirka KosekParamsThe following changes have been made to the
params code
since the 1.70.0 release.Added three new attribute sets (revhistory.title.properties, revhistory.table.properties and revhistory.table.cell.properties) for controlling appearance of revhistory in FO output.Modified: fo/block.xsl,1.34; fo/param.ent,1.101; fo/param.xweb,1.114; fo/titlepage.xsl,1.41; params/revhistory.table.cell.properties.xml,1.1; params/revhistory.table.properties.xml,1.1; params/revhistory.title.properties.xml,1.1 - Jirka KosekRelease: 1.70.0As with all DocBook Project dot-zero
releases, this is an experimental release. It will be followed shortly
by a stable release.This release adds a number of new features,
including:support for selecting alternative index-collation methods
(in particular, support for using a collation library developed by
Eliot Kimber)improved handling of DocBook 5 document instances (through a
namespace-stripping mechanism)full support for CALS and HTML tables in manpages
outputa mechanism for preserving relative URIs in documents that
make use of XIncludesupport for the "new" .90 version of
FOPenhanced capabilities for controlling formatting of lists in HTML
and FO outputautogeneration of AUTHOR and COPYRIGHT sections in manpages
outputsupport for generating crop marks in FO/PDF outputsupport for qandaset as a root element in FO outputsupport for floatstyle and orient on all table typessupport for floatstyle in figure, and examplepgwide.properties attribute-set supports extending figure,
example and table into the left indent area instead of spanning
multiple columns.The following is a detailed list of enhancements and API
changes that have been made since the 1.69.1 release.CommonThe following changes have been made to the
common code
since the 1.69.1 release.Add the xsl:key for the kimber
indexing method.Modified: common/autoidx-ng.xsl,1.2 - Robert
StaytonAdd support for
qandaset.Modified: common/labels.xsl,1.37;
common/subtitles.xsl,1.7; common/titles.xsl,1.35 - Robert
StaytonSupport dbhtml/dbfo start PI for
orderedlist numbering in both HTML and
FOModified: common/common.xsl,1.61; html/lists.xsl,1.50 - Norman
WalshAdded CVS
header.Modified: common/stripns.xsl,1.12 - Robert
StaytonChanged content model of text
element to ANY rather than #PCDATA because they could contain
markup.Modified: common/targetdatabase.dtd,1.7 - Robert
StaytonAdded
refentry.meta.get.quietly param.If zero (the
default), notes and warnings about "missing" markup are generated
during gathering of refentry metadata. If
non-zero, the metadata is gathered "quietly" -- that is, the
notes and warnings are suppressed.NOTE: If you are
processing a large amount of refentry content, you
may be able to speed up processing significantly by setting a
non-zero value for
refentry.meta.get.quietly.Modified: common/refentry.xsl,1.17;
manpages/param.ent,1.15; manpages/param.xweb,1.17;
params/refentry.meta.get.quietly.xml,1.1 - Michael(tm)
SmithAfter namespace stripping, the
source document is the temporary tree created by the stripping
process and it has the wrong base URI for relative
references. Earlier versions of this code used to try to fix that
by patching the elements with relative @fileref attributes. That
was inadequate because it calculated an absolute base URI
without considering that there might be xml:base attributes
already in effect. It seems obvious now that the right thing to
do is simply to put the xml:base on the root of the document. And
that seems to work.Modified: common/stripns.xsl,1.7 - Norman
WalshAdded support for "software" and
"sectdesc" class values on refmiscinfo; "software" is
treated identically to "source", and "setdesc" is treated
identically to "manual".Modified: common/refentry.xsl,1.10;
params/man.th.extra2.max.length.xml,1.3;
params/refentry.source.name.profile.xml,1.4 - Michael(tm)
SmithAdded support for DocBook 5
namespace-stripping in manpages stylesheet. Closes request
#1210692.Modified: common/common.xsl,1.56; manpages/docbook.xsl,1.57 -
Michael(tm) SmithAdded <xsl:template
match="/"> to make stripns.xsl usable as a standalone
stylesheet for stripping out DocBook 5/NG to DocBook 4. Note that
DocBook XSLT drivers that include this stylesheet all override
the match="/" template.Modified: common/stripns.xsl,1.4 - Michael(tm)
SmithNumber figures, examples, and
tables from book if there is no prefix (i.e. if
chapter.autolabel is set to 0). This avoids
having the list of figures where the figures mysteriously restart
their numeration periodically when
chapter.autolabel is set to
0.Modified: common/labels.xsl,1.36 - David CramerAdd task template in
title.markup mode.Modified: common/titles.xsl,1.34 - Robert
StaytonAdd children (with ids) of formal
objects to target data.Modified: common/targets.xsl,1.10 - Robert
StaytonAdded support for case when
personname doesn't contain specific name markup (as allowed
in DocBook 5.0)Modified: common/common.xsl,1.54 - Jirka
KosekExtensionsThe following changes have been made to the
extensions code
since the 1.69.1 release.Support Xalan
2.7Modified: extensions/xalan27/.cvsignore,1.1;
extensions/xalan27/build.xml,1.1;
extensions/xalan27/nbproject/.cvsignore,1.1;
extensions/xalan27/nbproject/build-impl.xml,1.1;
extensions/xalan27/nbproject/genfiles.properties,1.1;
extensions/xalan27/nbproject/project.properties,1.1;
extensions/xalan27/nbproject/project.xml,1.1;
extensions/xalan27/src/com/nwalsh/xalan/CVS.java,1.1;
extensions/xalan27/src/com/nwalsh/xalan/Callout.java,1.1;
extensions/xalan27/src/com/nwalsh/xalan/FormatCallout.java,1.1;
extensions/xalan27/src/com/nwalsh/xalan/FormatDingbatCallout.java,1.1;
extensions/xalan27/src/com/nwalsh/xalan/FormatGraphicCallout.java,1.1;
extensions/xalan27/src/com/nwalsh/xalan/FormatTextCallout.java,1.1;
extensions/xalan27/src/com/nwalsh/xalan/FormatUnicodeCallout.java,1.1;
extensions/xalan27/src/com/nwalsh/xalan/Func.java,1.1;
extensions/xalan27/src/com/nwalsh/xalan/ImageIntrinsics.java,1.1;
extensions/xalan27/src/com/nwalsh/xalan/Params.java,1.1;
extensions/xalan27/src/com/nwalsh/xalan/Table.java,1.1;
extensions/xalan27/src/com/nwalsh/xalan/Text.java,1.1;
extensions/xalan27/src/com/nwalsh/xalan/Verbatim.java,1.1 - Norman
WalshHandle the case where the imageFn
is actually a URI. This still needs
work.Modified: extensions/saxon643/com/nwalsh/saxon/ImageIntrinsics.java,1.4
- Norman WalshFOThe following changes have been made to the
fo code
since the 1.69.1 release.Adapted to the new indexing
code. Now works just like a wrapper that calls kosek indexing method,
originally implemented here.Modified: fo/autoidx-ng.xsl,1.5 - Jirka
KosekAdded parameters for header/footer
table minimum height.Modified: fo/pagesetup.xsl,1.60;
fo/param.ent,1.100; fo/param.xweb,1.113 - Robert
StaytonAdd the index.method
parameter.Modified: fo/param.ent,1.99; fo/param.xweb,1.112 - Robert
StaytonIntegrate support for three
indexing methods: - the original English-only method. -
Jirka Kosek's method using EXSLT extensions. - Eliot Kimber's
method using Saxon extensions. Use the 'index.method'
parameter to select.Modified: fo/autoidx.xsl,1.38 - Robert
StaytonAdd support for TOC for
qandaset in fo output.Modified: fo/autotoc.xsl,1.30;
fo/qandaset.xsl,1.20 - Robert StaytonAdded parameter
ulink.hyphenate.chars. Added parameter
insert.link.page.number.Modified: fo/param.ent,1.98;
fo/param.xweb,1.111 - Robert StaytonImplemented feature request
#942524 to add insert.link.page.number to allow link
element cross references to have a page number.Modified: fo/xref.xsl,1.67 -
Robert StaytonAdd support for
ulink.hyphenate.chars so more characters
can be break points in urls.Modified: fo/xref.xsl,1.66 - Robert
StaytonImplemented patch #1075144 to make
the url text in a ulink in FO output an active link as
well.Modified: fo/xref.xsl,1.65 - Robert Staytontable footnotes now
have their own table.footnote.properties
attribute set.Modified: fo/footnote.xsl,1.23 - Robert
StaytonAdd qandaset to
root.elements.Modified: fo/docbook.xsl,1.41 - Robert
StaytonAdded mode="page.sequence" to make
it easier to put content into a page sequence. First used for
qandaset.Modified: fo/component.xsl,1.37 - Robert
StaytonImplemented feature request
#1434408 to support formatting
of biblioentry.Modified: fo/biblio.xsl,1.35 - Robert
StaytonAdded
biblioentry.properties.Modified: fo/param.ent,1.97;
fo/param.xweb,1.110 - Robert StaytonSupport PTC/Arbortext
bookmarksModified: fo/docbook.xsl,1.40; fo/ptc.xsl,1.1 - Norman
WalshAdded
table.footnote.properties to permit
table footnotes to format differently from regular
footnotes.Modified: fo/param.ent,1.96; fo/param.xweb,1.109 - Robert
StaytonRefactored table
templates to unify their processing and support all options in
all types. Now table and informaltable, in
both Cals and Html markup, use the same templates where possible,
and all support pgwide, rotation, and floats. There is also a
placeholder table.container template to
support wrapping a table in a layout table,
so the XEP tabletitle "continued"
extension can be more easily implemented.Modified: fo/formal.xsl,1.52;
fo/htmltbl.xsl,1.9; fo/table.xsl,1.48 - Robert
StaytonAdded new attribute set
toc.line.properties for controlling appearance of lines in
ToC/LoTModified: fo/autotoc.xsl,1.29; fo/param.ent,1.95;
fo/param.xweb,1.108 - Jirka KosekAdded support for float to example
and equation. Added support for pgwide to
figure, example, and equation (the latter
two via a dbfo pgwide="1" processing
instruction).Modified: fo/formal.xsl,1.51 - Robert
StaytonAdd pgwide.properties
attribute-set.Modified: fo/param.ent,1.94; fo/param.xweb,1.107 - Robert
StaytonAdded refclass.suppress
param.If the value of refclass.suppress is
non-zero, then display refclass contents is suppressed
in output. Affects HTML and FO output
only.Modified: fo/param.ent,1.93; fo/param.xweb,1.106; html/param.ent,1.90;
html/param.xweb,1.99; params/refclass.suppress.xml,1.1 - Michael(tm)
SmithImproved support for
task subelementsModified: fo/task.xsl,1.3; html/task.xsl,1.3 -
Jirka KosekAdjusted spacing around
K&R-formatted Funcdef and Paramdef
output such that it can more easily be discerned where one ends
and the other begins. Closes #1213264.Modified: fo/synop.xsl,1.18 -
Michael(tm) SmithMade handling of
paramdef/parameter in FO output consistent with that in HTML and
manpages output. Closes #1213259.Modified: fo/synop.xsl,1.17 - Michael(tm)
SmithMade handling of
Refnamediv consistent with formatting in HTML
and manpages output; specifically, changed so that
Refname (comma-separated list of multiple instances
found) is used (instead of Refentrytitle as
previously), then em-dash, then the Refpurpose. Closes
#1212562.Modified: fo/refentry.xsl,1.30 - Michael(tm)
SmithAdded output of
Releaseinfo to recto titlepage ("copyright"
page) for Book in FO output. This makes it consistent
with HTML output. Closes #1327034. Thanks to Paul DuBois for
reporting.Modified: fo/titlepage.templates.xml,1.28 - Michael(tm)
SmithAdded condition for setting
block-progression-dimension.minimum on table-row, instead of
height, when fop1.extensions is
non-zero. For an explanation of the reason for the change,
see: http://wiki.apache.org/xmlgraphics-fop/Troubleshooting/CommonLogMessagesModified: fo/pagesetup.xsl,1.59
- Michael(tm) SmithAdded new
refclass.suppress param for suppressing display
of Refclass in HTML and FO output. Did not add it to
manpages because manpages stylesheet is currently just silently
ignoring Refclass anyway. Closes request
#1461065. Thanks to Davor Ocelic (docelic) for
reporting.Modified: fo/refentry.xsl,1.29; html/refentry.xsl,1.23 -
Michael(tm) SmithAdd support for keep-together PI
to informal objects.Modified: fo/formal.xsl,1.50 - Robert
StaytonAdd support for
fop1.extensions.Modified: fo/formal.xsl,1.49;
fo/graphics.xsl,1.44; fo/table.xsl,1.47 - Robert
StaytonAdd support for fop1
bookmarks.Modified: fo/docbook.xsl,1.39 - Robert
StaytonAdd fop1.extentions parameter to
add support for fop development version.Modified: fo/param.ent,1.92;
fo/param.xweb,1.105 - Robert StaytonStart supporting fop development
version, which will become fop version 1.Modified: fo/fop1.xsl,1.1 -
Robert StaytonAdd template for task
in mode="xref-to".Modified: fo/xref.xsl,1.63; html/xref.xsl,1.57 - Robert
Staytontable footnotes now
also get footnote.properties
attribute-set.Modified: fo/footnote.xsl,1.22 - Robert
StaytonAdded index.separator
named template to compute the separator punctuation based on
locale.Modified: fo/autoidx.xsl,1.36 - Robert StaytonAdded support for link,
olink, and xref within OO
Classsynopsis and children. (Because DocBook NG/5
allows it).Modified: fo/synop.xsl,1.15; html/synop.xsl,1.19 - Michael(tm)
SmithSupport date as an
inlineModified: fo/inline.xsl,1.43; html/inline.xsl,1.46 - Norman
WalshAdded new parameter
keep.relative.image.urisModified: fo/param.ent,1.91;
fo/param.xweb,1.104; html/param.ent,1.87; html/param.xweb,1.96;
params/keep.relative.image.uris.xml,1.1 - Norman
WalshMap Unicode space characters
U+2000-U+200A to fo:leaders.Modified: fo/docbook.xsl,1.38;
fo/passivetex.xsl,1.4; fo/spaces.xsl,1.1 - Jirka
KosekOutput a real em dash for em-dash
dingbat (instead of two hypens).Modified: fo/fo.xsl,1.7 - Michael(tm)
SmithSupport default label
width parameters for itemized and ordered listsModified: fo/lists.xsl,1.64;
fo/param.ent,1.90; fo/param.xweb,1.103;
params/itemizedlist.label.width.xml,1.1;
params/orderedlist.label.width.xml,1.1 - Norman
WalshGenerate localized
title for Refsynopsisdiv if no
appropriate Title descendant found in source. Closes
#1212398. This change makes behavior for the Synopsistitle consistent with the behavior of HTML and
manpages output.Also, added
xsl:use-attribute-sets="normal.para.spacing" to
block generated for Cmdsynopsis output. Previously,
that block had no spacing at all specified, which resulted it
being crammed up to closely to the Synopsis
head.Modified: fo/refentry.xsl,1.28; fo/synop.xsl,1.13 - Michael(tm)
SmithAdded parameters to support
localization of index
item punctuation.Modified: fo/autoidx.xsl,1.35 - Robert
StaytonAdded
index.number.separator,
index.range.separator,
and index.term.separator parameters to
support localization of punctuation in index
entries.Modified: fo/param.ent,1.89; fo/param.xweb,1.102 - Robert
StaytonAdded "Cross References"
section in HTML doc (for consistency with the FO
doc). Also, moved the existing FO "Cross
References" section to follow the "Linking"
section.Modified: fo/param.xweb,1.101; html/param.xweb,1.95 -
Michael(tm) SmithAdded ID attribues to all
Reference elements (e.g., id="tables" for the doc for
section on Table params). So pages for
all subsections of ref docs now have stable filenames instead
of arbitrary generated filenames.Modified: fo/param.xweb,1.100;
html/param.xweb,1.94 - Michael(tm) SmithAdded two new parameters for
handling of multi-term
varlistentry elements:variablelist.term.break.after:
When the variablelist.term.break.after is
non-zero, it will generate a line break after each
term multi-term
varlistentry.variablelist.term.separator:
When a varlistentry contains multiple term
elements, the string specified in the value of the
variablelist.term.separator parameter is
placed after each term except the last. The default
is ", " (a comma followed by a space). To suppress rendering of
the separator, set the value of
variablelist.term.separator to the empty
string ("").These parameters are primarily intended to be
useful if you have multi-term varlistentries that have long
terms.Closes #1306676. Thanks to Sam Steingold for
providing an example "lots of long terms" doc that demonstrated
the value of having these options.Also, added
normalize-space() call to processing of each
term.This change affects all output formats
(HTML, PDF, manpages). The default behavior should pretty much
remain the same as before, but it is possible (as always) that
the change may introduce some
new bugginess.Modified: fo/lists.xsl,1.62; fo/param.ent,1.88;
fo/param.xweb,1.99; html/lists.xsl,1.48; html/param.ent,1.86;
html/param.xweb,1.93; manpages/lists.xsl,1.22;
manpages/param.ent,1.14; manpages/param.xweb,1.16;
params/variablelist.term.break.after.xml,1.1;
params/variablelist.term.separator.xml,1.1 - Michael(tm)
SmithAdd sidebar titlepage
placeholder attset for styles.Modified: fo/titlepage.xsl,1.37 - Robert
StaytonAdd titlepage for
sidebar.Modified: fo/titlepage.templates.xml,1.27 - Robert
StaytonImplemented RFE
#1292615.Added bunch of new parameters (attribute sets)
that affect list presentation: list.block.properties,
itemizedlist.properties, orderedlist.properties,
itemizedlist.label.properties and
orderedlist.label.properties. Default behaviour
of stylesheets has not been changed but further customizations will be
much more easier.Modified: fo/lists.xsl,1.61; fo/param.ent,1.87;
fo/param.xweb,1.98; params/itemizedlist.label.properties.xml,1.1;
params/itemizedlist.properties.xml,1.1;
params/list.block.properties.xml,1.1;
params/orderedlist.label.properties.xml,1.1;
params/orderedlist.properties.xml,1.1 - Jirka
KosekImplemented RFE
#1242092.You can enable crop marks in your document by
setting crop.marks=1 and xep.extensions=1. Appearance of crop
marks can be controlled by parameters
crop.mark.bleed (6pt),
crop.mark.offset (24pt) and
crop.mark.width (0.5pt).Also there
is new named template called user-xep-pis. You can overwrite it in
order to produce some PIs that can control XEP as described in
http://www.renderx.com/reference.html#Output_FormatsModified: fo/docbook.xsl,1.36;
fo/param.ent,1.86; fo/param.xweb,1.97; fo/xep.xsl,1.23;
params/crop.mark.bleed.xml,1.1; params/crop.mark.offset.xml,1.1;
params/crop.mark.width.xml,1.1; params/crop.marks.xml,1.1 - Jirka
KosekHTMLThe following changes have been made to the
html code
since the 1.69.1 release.implemented
index.method parameter and three
methods.Modified: html/autoidx.xsl,1.28 - Robert
Staytonadded index.method
parameter to support 3 indexing methods.Modified: html/param.ent,1.94;
html/param.xweb,1.103 - Robert StaytonImplemented feature request
#1072510 as a processing instruction to permit including external
HTML content into HTML output.Modified: html/pi.xsl,1.9 - Robert
StaytonAdded new parameter
chunk.tocs.and.lots.has.title which
controls presence of title in a separate chunk with
ToC/LoT. Disabling title can be very useful if you are
generating frameset output (well, yes those frames, but some customers
really want them ;-).Modified: html/chunk-code.xsl,1.15;
html/param.ent,1.93; html/param.xweb,1.102;
params/chunk.tocs.and.lots.has.title.xml,1.1 - Jirka
KosekSupport dbhtml/dbfo start PI for
orderedlist numbering in both HTML and
FOModified: common/common.xsl,1.61; html/lists.xsl,1.50 - Norman
WalshAllow ToC without
title also for set and
book.Modified: html/autotoc.xsl,1.37; html/division.xsl,1.12 -
Jirka KosekImplemented floats uniformly for
figure, example, equation
and informalfigure, informalexample, and
informalequation.Modified: html/formal.xsl,1.22 - Robert
StaytonAdded the
autotoc.label.in.hyperlink param.If the value
of autotoc.label.in.hyperlink is non-zero, labels
are included in hyperlinked titles in the TOC. If it
is instead zero, labels are still displayed prior to the
hyperlinked titles, but are not hyperlinked along with the
titles.Closes patch #1065868. Thanks to anatoly techtonik
for the patch.Modified: html/autotoc.xsl,1.36; html/param.ent,1.92;
html/param.xweb,1.101; params/autotoc.label.in.hyperlink.xml,1.1 -
Michael(tm) SmithAdded two new params:
html.head.legalnotice.link.types
and html.head.legalnotice.link.multiple.If
the value of the generate.legalnotice.link is
non-zero, then the stylesheet generates (in the head
section of the HTML source) either a single HTML
link element or, if the value of
the html.head.legalnotice.link.multiple is
non-zero, one link element for each link
type specified. Each link has the
following attributes: - a rel attribute whose value
is derived from the value of
html.head.legalnotice.link.types -
an href attribute whose value is set to the URL of the file
containing the legalnotice - a title
attribute whose value is set to the title of the
corresponding legalnotice (or a title
programatically determined by the stylesheet)For
example: <link rel="copyright"
href="ln-id2524073.html" title="Legal Notice">Closes
#1476450. Thanks to Sam Steingold.Modified: html/chunk-common.xsl,1.45;
html/param.ent,1.91; html/param.xweb,1.100;
params/generate.legalnotice.link.xml,1.4;
params/html.head.legalnotice.link.multiple.xml,1.1;
params/html.head.legalnotice.link.types.xml,1.1 - Michael(tm)
SmithAdded refclass.suppress
param.If the value of refclass.suppress is
non-zero, then display refclass contents is suppressed
in output. Affects HTML and FO output
only.Modified: fo/param.ent,1.93; fo/param.xweb,1.106; html/param.ent,1.90;
html/param.xweb,1.99; params/refclass.suppress.xml,1.1 - Michael(tm)
SmithImproved support for
task subelementsModified: fo/task.xsl,1.3; html/task.xsl,1.3 -
Jirka KosekAdded new
refclass.suppress param for suppressing display
of Refclass in HTML and FO output. Did not add it to
manpages because manpages stylesheet is currently just silently
ignoring Refclass anyway. Closes request
#1461065. Thanks to Davor Ocelic (docelic) for
reporting.Modified: fo/refentry.xsl,1.29; html/refentry.xsl,1.23 -
Michael(tm) SmithProcess alt text with
normalize-space(). Replace tab indents with
spaces.Modified: html/graphics.xsl,1.57 - Robert
StaytonContent of citation
element is automatically linked to the bibliographic entry
with the corresponding abbrev.Modified: html/biblio.xsl,1.26;
html/inline.xsl,1.47; html/xref.xsl,1.58 - Jirka
KosekAdd template for task
in mode="xref-to".Modified: fo/xref.xsl,1.63; html/xref.xsl,1.57 - Robert
StaytonSuppress ID warnings if the
.warnings parameter is 0Modified: html/html.xsl,1.17 - Norman
WalshAdd support for floatstyle to
figure.Modified: html/formal.xsl,1.21 - Robert
StaytonHandling of xref to
area/areaset need support in extensions code also. I currently have no
time to touch extensions code, so code is here to be enabled when
extension is fixed also.Modified: html/xref.xsl,1.56 - Jirka
KosekAdded 3 parameters for overriding
gentext for index
punctuation.Modified: html/param.ent,1.89; html/param.xweb,1.98 - Robert
StaytonAdded parameters to support
localization of index item punctuation. Added
index.separator named template to compute
the separator punctuation based on
locale.Modified: html/autoidx.xsl,1.27 - Robert
StaytonAdded a <div
class="{$class}-contents"> wrapper around output of contents
of all formal objects. Also, added an optional <br
class="{class}-break"/> linebreak after all formal
objects.WARNING: Because this change places an additional
DIV between the DIV wrapper for the equation and the
equation contents, it may break some existing CSS
stylesheets that have been created with the assumption that there
would never be an intervening DIV there.The following is
an example of what Equation output looks like as a
result of the changes described above. <div
class="equation"> <a name="three"
id="three"></a> <p
class="title"><b>(1.3)</b></p>
<div class="equation-contents"> <span
class="mathphrase">1+1=3</span>
</div> </div><br
class="equation-break">Rationale: These changes allow
CSS control of the placement of the formal-object
title relative to the formal-object
contents. For example, using the CSS "float" property
enables the title and contents to be rendered on the
same line. Example stylesheet: .equation
{ margin-top: 20px; margin-bottom: 20px; }
.equation-contents { float: left; }
.equation .title { margin-top: 0;
float: right; margin-right: 200px; }
.equation .title b { font-weight:
normal; } .equation-break { clear: both;
}Note that the purpose of the ".equation-break" class is
to provide a way to clear off the floats.If you want
to instead have the equationtitle rendered to
the left of the equation contents, you can do
something like this: .equation {
margin-top: 20px; width: 300px; margin-bottom: 20px;
} .equation-contents { float: right; }
.equation .title { margin-top: 0;
float: left; margin-right: 200px; }
.equation .title b { font-weight:
normal; } .equation-break { clear: both;
}Modified: html/formal.xsl,1.20 - Michael(tm) SmithAdded a chunker.output.quiet
top-level parameter so that the chunker can be made quiet by
defaultModified: html/chunker.xsl,1.26 - Norman WalshAdded support for link,
olink, and xref within OO
Classsynopsis and children. (Because DocBook NG/5
allows it).Modified: fo/synop.xsl,1.15; html/synop.xsl,1.19 - Michael(tm)
SmithNew parameter:
id.warnings. If non-zero, warnings are
generated for titled objects that don't have titles. True by default;
I wonder if this will be too aggressive?Modified: html/biblio.xsl,1.25;
html/component.xsl,1.27; html/division.xsl,1.11; html/formal.xsl,1.19;
html/glossary.xsl,1.20; html/html.xsl,1.13; html/index.xsl,1.16;
html/param.ent,1.88; html/param.xweb,1.97; html/refentry.xsl,1.22;
html/sections.xsl,1.30; params/id.warnings.xml,1.1 - Norman
WalshIf the
keep.relative.image.uris parameter is true,
don't use the absolute URI (as calculated from xml:base) in
the img src attribute, us the value the author
specified. Note that we still have to calculate the absolute
filename for use in the image intrinsics
extension.Modified: html/graphics.xsl,1.56 - Norman
WalshSupport date as an
inlineModified: fo/inline.xsl,1.43; html/inline.xsl,1.46 - Norman
WalshAdded new parameter
keep.relative.image.urisModified: fo/param.ent,1.91;
fo/param.xweb,1.104; html/param.ent,1.87; html/param.xweb,1.96;
params/keep.relative.image.uris.xml,1.1 - Norman
WalshAdded two new parameters for
handling of multi-term
varlistentry elements:variablelist.term.break.after:
When the variablelist.term.break.after is
non-zero, it will generate a line break after each
term multi-term
varlistentry.variablelist.term.separator:
When a varlistentry contains multiple term
elements, the string specified in the value of the
variablelist.term.separator parameter is
placed after each term except the last. The default
is ", " (a comma followed by a space). To suppress rendering of
the separator, set the value of
variablelist.term.separator to the empty
string ("").These parameters are primarily intended to be
useful if you have multi-term varlistentries that have long
terms.Closes #1306676. Thanks to Sam Steingold for
providing an example "lots of long terms" doc that demonstrated
the value of having these options.Also, added
normalize-space() call to processing of each
term.This change affects all output formats
(HTML, PDF, manpages). The default behavior should pretty much
remain the same as before, but it is possible (as always) that
the change may introduce some
new bugginess.Modified: fo/lists.xsl,1.62; fo/param.ent,1.88;
fo/param.xweb,1.99; html/lists.xsl,1.48; html/param.ent,1.86;
html/param.xweb,1.93; manpages/lists.xsl,1.22;
manpages/param.ent,1.14; manpages/param.xweb,1.16;
params/variablelist.term.break.after.xml,1.1;
params/variablelist.term.separator.xml,1.1 - Michael(tm)
SmithAdded "wrapper-name" param to
inline.charseq named template, enabling it to output inlines
other than just "span". Acronym and Abbrev
templates now use inline.charseq to output HTML
"acronym" and "abbr" elements (instead of
"span"). Closes #1305468. Thanks to Sam Steingold for suggesting
the change.Modified: html/inline.xsl,1.45 - Michael(tm)
SmithManpagesThe following changes have been made to the
manpages code
since the 1.69.1 release.Added the following
params: - man.indent.width (string-valued) -
man.indent.refsect (boolean) - man.indent.blurbs (boolean)
- man.indent.lists (boolean) - man.indent.verbatims
(boolean)Note that in earlier snapshots, man.indent.width
was named man.indentation.default.value and the boolean params
had names like man.indentation.*.adjust. Also the
man.indent.blurbs param was called man.indentation.authors.adjust
(or something).The behavior now is: If the value of a
particular man.indent.* boolean param is non-zero, the
corresponding contents (refsect*, list items,
authorblurb/personblurb, vervatims) are displayed with a left
margin indented by a width equal to the value
of man.indent.width.Modified: params/man.indent.blurbs.xml,1.1;
manpages/docbook.xsl,1.74; manpages/info.xsl,1.20;
manpages/lists.xsl,1.30; manpages/other.xsl,1.20;
manpages/param.ent,1.22; manpages/param.xweb,1.24;
manpages/refentry.xsl,1.14; params/man.indent.lists.xml,1.1;
params/man.indent.refsect.xml,1.1;
params/man.indent.verbatims.xml,1.1; params/man.indent.width.xml,1.1 -
Michael(tm) SmithAdded
man.table.footnotes.divider param.In each
table that contains footenotes, the string specified
by the man.table.footnotes.divider parameter is output
before the list of footnotes for the
table.Modified: manpages/docbook.xsl,1.73;
manpages/links.xsl,1.6; manpages/param.ent,1.21;
manpages/param.xweb,1.23; params/man.table.footnotes.divider.xml,1.1 -
Michael(tm) SmithAdded the
man.output.in.separate.dir,
man.output.base.dir,
and man.output.subdirs.enabled parameters.The
man.output.base.dir parameter specifies the
base directory into which man-page files are
output. The man.output.subdirs.enabled parameter controls whether
the files are output in subdirectories within the base
directory.The values of the
man.output.base.dir
and man.output.subdirs.enabled parameters are used only if the
value of man.output.in.separate.dir parameter is non-zero. If the
value of man.output.in.separate.dir is zero, man-page files are
not output in a separate
directory.Modified: manpages/docbook.xsl,1.72; manpages/param.ent,1.20;
manpages/param.xweb,1.22; params/man.output.base.dir.xml,1.1;
params/man.output.in.separate.dir.xml,1.1;
params/man.output.subdirs.enabled.xml,1.1 - Michael(tm)
SmithAdded
man.font.table.headings and
man.font.table.title params, for
controlling font in table headings and
titles.Modified: manpages/docbook.xsl,1.71; manpages/param.ent,1.19;
manpages/param.xweb,1.21; params/man.font.table.headings.xml,1.1;
params/man.font.table.title.xml,1.1 - Michael(tm)
SmithAdded
man.font.funcsynopsisinfo and
man.font.funcprototype params, for specifying the roff
font (for example, BI, B, I) for funcsynopsisinfo and
funcprototype output.Modified: manpages/block.xsl,1.19;
manpages/docbook.xsl,1.69; manpages/param.ent,1.18;
manpages/param.xweb,1.20; manpages/synop.xsl,1.29;
manpages/table.xsl,1.21; params/man.font.funcprototype.xml,1.1;
params/man.font.funcsynopsisinfo.xml,1.1 - Michael(tm)
SmithAdded
man.segtitle.suppress param.If the value of
man.segtitle.suppress is non-zero, then display
of segtitle contents is suppressed in
output.Modified: manpages/docbook.xsl,1.68; manpages/param.ent,1.17;
manpages/param.xweb,1.19; params/man.segtitle.suppress.xml,1.1 -
Michael(tm) SmithAdded
man.output.manifest.enabled and
man.output.manifest.filename params.If
man.output.manifest.enabled is non-zero, a list
of filenames for man pages generated by the stylesheet
transformation is written to the file named by
man.output.manifest.filenameModified: manpages/docbook.xsl,1.67;
manpages/other.xsl,1.19; manpages/param.ent,1.16;
manpages/param.xweb,1.18; params/man.output.manifest.enabled.xml,1.1;
params/man.output.manifest.filename.xml,1.1;
tools/make/Makefile.DocBook,1.4 - Michael(tm)
SmithAdded
refentry.meta.get.quietly param.If zero (the
default), notes and warnings about "missing" markup are generated
during gathering of refentry metadata. If
non-zero, the metadata is gathered "quietly" -- that is, the
notes and warnings are suppressed.NOTE: If you are
processing a large amount of refentry content, you
may be able to speed up processing significantly by setting a
non-zero value for
refentry.meta.get.quietly.Modified: common/refentry.xsl,1.17;
manpages/param.ent,1.15; manpages/param.xweb,1.17;
params/refentry.meta.get.quietly.xml,1.1 - Michael(tm)
SmithChanged names of all boolean
indentation params to man.indent.* Also discarded individual
man.indent.*.value params and switched to just using a common
man.indent.width param (3n by default).Modified: manpages/docbook.xsl,1.66;
manpages/info.xsl,1.19; manpages/lists.xsl,1.29;
manpages/other.xsl,1.18; manpages/refentry.xsl,1.13 - Michael(tm)
SmithAdded boolean
man.output.in.separate.dir param, to control whether or not man
files are output in separate directory.Modified: manpages/docbook.xsl,1.65;
manpages/utility.xsl,1.14 - Michael(tm) SmithAdded options for controlling
indentation of verbatim output. Controlled through the
man.indentation.verbatims.adjust
and man.indentation.verbatims.value params. Closes
#1242997Modified: manpages/block.xsl,1.15; manpages/docbook.xsl,1.64 -
Michael(tm) SmithAdded options for controlling
indentation in lists and in *blurb output in the AUTHORS
section. Controlled through
the man.indentation.lists.adjust,
man.indentation.lists.value, man.indentation.authors.adjust, and
man.indentation.authors.value parameters. Default is 3 characters
(instead of the roff default of 8 characters). Closes
#1449369.Also, removed the indent that was being set on
informalexample outuput. I will instead add an option
for indenting verbatims, which I think is what the
informalexample indent was intended
for originally.Modified: manpages/block.xsl,1.14;
manpages/docbook.xsl,1.63; manpages/info.xsl,1.18;
manpages/lists.xsl,1.28 - Michael(tm) SmithChanged line-spacing call before
synopfragment to use ".sp -1n" ("n" units specified)
instead of plain ".sp -1"Modified: manpages/synop.xsl,1.28 - Michael(tm)
SmithAdded support for writing man
files into a specific output directory and into appropriate
subdirectories within that output directory. Controlled through
the man.base.dir parameter (similar to the
base.dir support in the HTML stylesheet) and
the man.subdirs.enabled parameter, which automatically determines
the name of an appropriate subdir (for example, man/man7,
man/man1, etc.) based on the section number/manvolnum
of the source Refentry.Closes #1255036 and
#1170317. Thanks to Denis Bradford for the original feature
request, and to Costin Stroie for submitting a patch that was
very helpful in implementing the
support.Modified: manpages/docbook.xsl,1.62; manpages/utility.xsl,1.13 -
Michael(tm) SmithRefined XPath statements and
notification messages for refentry metadata
handling.Modified: common/common.xsl,1.59; common/refentry.xsl,1.14;
manpages/docbook.xsl,1.61; manpages/other.xsl,1.17 - Michael(tm)
SmithAdded support for
copyright and legalnotice. The manpages
stylesheets now output a COPYRIGHTsection,
after the AUTHORS section, if a copyright
or legalnotice is found in the source. The
section contains the copyright contents followed
by the legalnotice contents. Closes
#1450209.Modified: manpages/docbook.xsl,1.59; manpages/info.xsl,1.17 -
Michael(tm) SmithDrastically reworked all of the
XPath expressions used in refentry metadata gathering
-- completely removed $parentinfo and turned $info into a set of
nodes that includes the *info contents of the Refentry
plus the *info contents all all of its ancestor elements. The
basic XPath expression now used throughout is (using the example
of checking for a date):
(($info[//date])[last()]/date)[1].That selects the "last"
*info/date date in document order -- that is, the one
eitther on the Refentry itself or on the
closest ancestor to the Refentry.It's
likely this change may break some things; may need to pick up
some pieces later.Also, changed the default value for the
man.th.extra2.max.length from 40 to
30.Modified: common/common.xsl,1.58; common/refentry.xsl,1.7;
params/man.th.extra2.max.length.xml,1.2;
params/refentry.date.profile.xml,1.2;
params/refentry.manual.profile.xml,1.2;
params/refentry.source.name.profile.xml,1.2;
params/refentry.version.profile.xml,1.2; manpages/docbook.xsl,1.58;
manpages/other.xsl,1.15 - Michael(tm) SmithAdded support for DocBook 5
namespace-stripping in manpages stylesheet. Closes request
#1210692.Modified: common/common.xsl,1.56; manpages/docbook.xsl,1.57 -
Michael(tm) SmithFixed handling of table
footnotes. With this checkin, the table support in the
manpages stylesheet is now basically feature complete. So this
change closes request #619532, "No support for tables" -- the
oldest currently open manpages feature request, submitted by Ben
Secrest (blsecres) on 2002-10-07. Congratulations to me [patting
myself on the back].Modified: manpages/block.xsl,1.11;
manpages/docbook.xsl,1.55; manpages/table.xsl,1.15 - Michael(tm)
SmithAdded handling for
table titles. Also fixed handling of nested tables;
nest tables are now "extracted" and displayed just after their
parent tables.Modified: manpages/docbook.xsl,1.54; manpages/table.xsl,1.14
- Michael(tm) SmithAdded option for turning off bold
formatting in Funcsynopsis. Boldface formatting in
functionsynopsis is mandated in the
man(7) man page and is used almost universally in existing man
pages. Despite that, it really does look like crap to have an
entire Funcsynopsis output in bold, so I added params
for turning off the bold formatting and/or replacing it with a
different roff special font (e.g., "RI" for alternating
roman/italic instead of the default "BI" for alternating
bold/italic). The new params
are "man.funcprototype.font" and
"man.funcsynopsisinfo.font". To be documented
later.Closes #1452247. Thanks to Joe Orton for the feature
request.Modified: params/man.string.subst.map.xml,1.16;
manpages/block.xsl,1.10; manpages/docbook.xsl,1.51;
manpages/inline.xsl,1.16; manpages/synop.xsl,1.27 - Michael(tm)
SmithUse AUTHORS instead of
AUTHOR if we have multiple people to attribute. Also,
fixed checking such that we generate
authorsection even if we don't have an
author (as long as there is at least one other
person/entity we can put in the
section). Also adjusted assembly of content for
Author metainfo field such that we now not only use
author, but try to find a "best match" if we can't
find an author name to put there.Closes
#1233592. Thanks to Sam Steingold for the
request.Modified: manpages/info.xsl,1.12 - Michael(tm)
SmithChanges for request #1243027,
"Impove handling of AUTHORsection." This
adds support for Collab, Corpauthor, Corpcredt,
Orgname, Publishername, and
Publisher. Also adds support for output
of Affiliation and its children, and support for using
gentext strings for auto-attributing roles (Author,
Editor, Publisher, Translator, etc.). Also
did a lot of code cleanup and modularization of all the
AUTHOR handling code. And fixed a bug that was causing
Authorinfo to not be picked up correctly
for metainfo comment we embed in man-page
source.Modified: manpages/info.xsl,1.11 - Michael(tm)
SmithSupport bold output for
"emphasis remap='B'". (because Eric Raymond's
doclifter(1) tool converts groff source marked up with ".B"
request or "\fB" escapes to DocBook "emphasis
remap='B'".)Modified: manpages/inline.xsl,1.14 - Michael(tm)
SmithAdded support for
Segmentedlist. Details: Output is tabular, with no
option for "list" type output. Output for Segtitle
elements can be supressed by
setting man.segtitle.suppress. If Segtitle
content is output, it is rendered in italic type (not bold
because not all terminals support bold and so italic ensures the
stand out on those terminals). Extra space (.sp line) at end of
table code ensures that it gets handled correctly in
the case where its source is the child of a Para.
Closes feature-request #1400097. Thanks to Daniel Leidert for the
patch and push, and to Alastair Rankine for filing the original
feature request.Modified: manpages/lists.xsl,1.23;
manpages/utility.xsl,1.10 - Michael(tm) SmithImproved handling or
Author/Editor/Othercredit.Reworked content of
(non-visible) comment added at top of each page (metadata
stuff).Added support for generating a
manifest file (useful for cleaning up
after builds, etc.)Modified: manpages/docbook.xsl,1.46;
manpages/info.xsl,1.9; manpages/other.xsl,1.12;
manpages/utility.xsl,1.6 - Michael(tm) SmithAdded two new parameters for
handling of multi-term
varlistentry elements:variablelist.term.break.after:
When the variablelist.term.break.after is
non-zero, it will generate a line break after each
term multi-term
varlistentry.variablelist.term.separator:
When a varlistentry contains multiple term
elements, the string specified in the value of the
variablelist.term.separator parameter is
placed after each term except the last. The default
is ", " (a comma followed by a space). To suppress rendering of
the separator, set the value of
variablelist.term.separator to the empty
string ("").These parameters are primarily intended to be
useful if you have multi-term varlistentries that have long
terms.Closes #1306676. Thanks to Sam Steingold for
providing an example "lots of long terms" doc that demonstrated
the value of having these options.Also, added
normalize-space() call to processing of each
term.This change affects all output formats
(HTML, PDF, manpages). The default behavior should pretty much
remain the same as before, but it is possible (as always) that
the change may introduce some
new bugginess.Modified: fo/lists.xsl,1.62; fo/param.ent,1.88;
fo/param.xweb,1.99; html/lists.xsl,1.48; html/param.ent,1.86;
html/param.xweb,1.93; manpages/lists.xsl,1.22;
manpages/param.ent,1.14; manpages/param.xweb,1.16;
params/variablelist.term.break.after.xml,1.1;
params/variablelist.term.separator.xml,1.1 - Michael(tm)
SmithParamsThe following changes have been made to the
params code
since the 1.69.1 release.New parameters to set
header/footer table minimum
height.Modified: params/footer.table.height.xml,1.1;
params/header.table.height.xml,1.1 - Robert
StaytonSupport multiple indexing methods
for different languages.Modified: params/index.method.xml,1.1 - Robert
StaytonRemove qandaset and
qandadiv from generate.toc for fo
output because formerly it wasn't working, but now it is and
the default behavior should stay the
same.Modified: params/generate.toc.xml,1.8 - Robert
Staytonadd support for page number
references to link element
too.Modified: params/insert.link.page.number.xml,1.1 - Robert
StaytonAdd support for more characters to
hyphen on when ulink.hyphenate is turned
on.Modified: params/ulink.hyphenate.chars.xml,1.1;
params/ulink.hyphenate.xml,1.3 - Robert StaytonNew attribute-set to format
biblioentry and
bibliomixed.Modified: params/biblioentry.properties.xml,1.1 -
Robert StaytonAdded new parameter
chunk.tocs.and.lots.has.title which
controls presence of title in a separate chunk with
ToC/LoT. Disabling title can be very useful if you are
generating frameset output (well, yes those frames, but some customers
really want them ;-).Modified: html/chunk-code.xsl,1.15;
html/param.ent,1.93; html/param.xweb,1.102;
params/chunk.tocs.and.lots.has.title.xml,1.1 - Jirka
KosekAdded new attribute set
toc.line.properties for controlling appearance of lines in
ToC/LoTModified: params/toc.line.properties.xml,1.1 - Jirka
KosekAllow table footnotes
to have different properties from regular
footnotes.Modified: params/table.footnote.properties.xml,1.1 - Robert
StaytonSet properties for pgwide="1"
objects.Modified: params/pgwide.properties.xml,1.1 - Robert
StaytonAdded the
autotoc.label.in.hyperlink param.If the value
of autotoc.label.in.hyperlink is non-zero, labels
are included in hyperlinked titles in the TOC. If it
is instead zero, labels are still displayed prior to the
hyperlinked titles, but are not hyperlinked along with the
titles.Closes patch #1065868. Thanks to anatoly techtonik
for the patch.Modified: html/autotoc.xsl,1.36; html/param.ent,1.92;
html/param.xweb,1.101; params/autotoc.label.in.hyperlink.xml,1.1 -
Michael(tm) SmithAdded two new params:
html.head.legalnotice.link.types
and html.head.legalnotice.link.multiple.If
the value of the generate.legalnotice.link is
non-zero, then the stylesheet generates (in the head
section of the HTML source) either a single HTML
link element or, if the value of
the html.head.legalnotice.link.multiple is
non-zero, one link element for each link
type specified. Each link has the
following attributes: - a rel attribute whose value
is derived from the value of
html.head.legalnotice.link.types -
an href attribute whose value is set to the URL of the file
containing the legalnotice - a title
attribute whose value is set to the title of the
corresponding legalnotice (or a title
programatically determined by the stylesheet)For
example: <link rel="copyright"
href="ln-id2524073.html" title="Legal Notice">Closes
#1476450. Thanks to Sam Steingold.Modified: html/chunk-common.xsl,1.45;
html/param.ent,1.91; html/param.xweb,1.100;
params/generate.legalnotice.link.xml,1.4;
params/html.head.legalnotice.link.multiple.xml,1.1;
params/html.head.legalnotice.link.types.xml,1.1 - Michael(tm)
SmithAdded the following
params: - man.indent.width (string-valued) -
man.indent.refsect (boolean) - man.indent.blurbs (boolean)
- man.indent.lists (boolean) - man.indent.verbatims
(boolean)Note that in earlier snapshots, man.indent.width
was named man.indentation.default.value and the boolean params
had names like man.indentation.*.adjust. Also the
man.indent.blurbs param was called man.indentation.authors.adjust
(or something).The behavior now is: If the value of a
particular man.indent.* boolean param is non-zero, the
corresponding contents (refsect*, list items,
authorblurb/personblurb, vervatims) are displayed with a left
margin indented by a width equal to the value
of man.indent.width.Modified: params/man.indent.blurbs.xml,1.1;
manpages/docbook.xsl,1.74; manpages/info.xsl,1.20;
manpages/lists.xsl,1.30; manpages/other.xsl,1.20;
manpages/param.ent,1.22; manpages/param.xweb,1.24;
manpages/refentry.xsl,1.14; params/man.indent.lists.xml,1.1;
params/man.indent.refsect.xml,1.1;
params/man.indent.verbatims.xml,1.1; params/man.indent.width.xml,1.1 -
Michael(tm) SmithAdded
man.table.footnotes.divider param.In each
table that contains footenotes, the string specified
by the man.table.footnotes.divider parameter is output
before the list of footnotes for the
table.Modified: manpages/docbook.xsl,1.73;
manpages/links.xsl,1.6; manpages/param.ent,1.21;
manpages/param.xweb,1.23; params/man.table.footnotes.divider.xml,1.1 -
Michael(tm) SmithAdded the
man.output.in.separate.dir,
man.output.base.dir,
and man.output.subdirs.enabled parameters.The
man.output.base.dir parameter specifies the
base directory into which man-page files are
output. The man.output.subdirs.enabled parameter controls whether
the files are output in subdirectories within the base
directory.The values of the
man.output.base.dir
and man.output.subdirs.enabled parameters are used only if the
value of man.output.in.separate.dir parameter is non-zero. If the
value of man.output.in.separate.dir is zero, man-page files are
not output in a separate
directory.Modified: manpages/docbook.xsl,1.72; manpages/param.ent,1.20;
manpages/param.xweb,1.22; params/man.output.base.dir.xml,1.1;
params/man.output.in.separate.dir.xml,1.1;
params/man.output.subdirs.enabled.xml,1.1 - Michael(tm)
SmithAdded
man.font.table.headings and
man.font.table.title params, for
controlling font in table headings and
titles.Modified: manpages/docbook.xsl,1.71; manpages/param.ent,1.19;
manpages/param.xweb,1.21; params/man.font.table.headings.xml,1.1;
params/man.font.table.title.xml,1.1 - Michael(tm)
SmithAdded
man.font.funcsynopsisinfo and
man.font.funcprototype params, for specifying the roff
font (for example, BI, B, I) for funcsynopsisinfo and
funcprototype output.Modified: manpages/block.xsl,1.19;
manpages/docbook.xsl,1.69; manpages/param.ent,1.18;
manpages/param.xweb,1.20; manpages/synop.xsl,1.29;
manpages/table.xsl,1.21; params/man.font.funcprototype.xml,1.1;
params/man.font.funcsynopsisinfo.xml,1.1 - Michael(tm)
SmithChanged to select="0" in
refclass.suppress (instead of
..>0</..)Modified: params/refclass.suppress.xml,1.3 - Michael(tm)
SmithAdded
man.segtitle.suppress param.If the value of
man.segtitle.suppress is non-zero, then display
of segtitle contents is suppressed in
output.Modified: manpages/docbook.xsl,1.68; manpages/param.ent,1.17;
manpages/param.xweb,1.19; params/man.segtitle.suppress.xml,1.1 -
Michael(tm) SmithAdded
man.output.manifest.enabled and
man.output.manifest.filename params.If
man.output.manifest.enabled is non-zero, a list
of filenames for man pages generated by the stylesheet
transformation is written to the file named by
man.output.manifest.filenameModified: manpages/docbook.xsl,1.67;
manpages/other.xsl,1.19; manpages/param.ent,1.16;
manpages/param.xweb,1.18; params/man.output.manifest.enabled.xml,1.1;
params/man.output.manifest.filename.xml,1.1;
tools/make/Makefile.DocBook,1.4 - Michael(tm)
SmithAdded refclass.suppress
param.If the value of refclass.suppress is
non-zero, then display refclass contents is suppressed
in output. Affects HTML and FO output
only.Modified: fo/param.ent,1.93; fo/param.xweb,1.106; html/param.ent,1.90;
html/param.xweb,1.99; params/refclass.suppress.xml,1.1 - Michael(tm)
SmithAdded
refentry.meta.get.quietly param.If zero (the
default), notes and warnings about "missing" markup are generated
during gathering of refentry metadata. If
non-zero, the metadata is gathered "quietly" -- that is, the
notes and warnings are suppressed.NOTE: If you are
processing a large amount of refentry content, you
may be able to speed up processing significantly by setting a
non-zero value for
refentry.meta.get.quietly.Modified: common/refentry.xsl,1.17;
manpages/param.ent,1.15; manpages/param.xweb,1.17;
params/refentry.meta.get.quietly.xml,1.1 - Michael(tm)
SmithAdded support for "software" and
"sectdesc" class values on refmiscinfo; "software" is
treated identically to "source", and "setdesc" is treated
identically to "manual".Modified: common/refentry.xsl,1.10;
params/man.th.extra2.max.length.xml,1.3;
params/refentry.source.name.profile.xml,1.4 - Michael(tm)
SmithDrastically reworked all of the
XPath expressions used in refentry metadata gathering
-- completely removed $parentinfo and turned $info into a set of
nodes that includes the *info contents of the Refentry
plus the *info contents all all of its ancestor elements. The
basic XPath expression now used throughout is (using the example
of checking for a date):
(($info[//date])[last()]/date)[1].That selects the "last"
*info/date date in document order -- that is, the one
eitther on the Refentry itself or on the
closest ancestor to the Refentry.It's
likely this change may break some things; may need to pick up
some pieces later.Also, changed the default value for the
man.th.extra2.max.length from 40 to
30.Modified: common/common.xsl,1.58; common/refentry.xsl,1.7;
params/man.th.extra2.max.length.xml,1.2;
params/refentry.date.profile.xml,1.2;
params/refentry.manual.profile.xml,1.2;
params/refentry.source.name.profile.xml,1.2;
params/refentry.version.profile.xml,1.2; manpages/docbook.xsl,1.58;
manpages/other.xsl,1.15 - Michael(tm) SmithAdded option for turning off bold
formatting in Funcsynopsis. Boldface formatting in
functionsynopsis is mandated in the
man(7) man page and is used almost universally in existing man
pages. Despite that, it really does look like crap to have an
entire Funcsynopsis output in bold, so I added params
for turning off the bold formatting and/or replacing it with a
different roff special font (e.g., "RI" for alternating
roman/italic instead of the default "BI" for alternating
bold/italic). The new params
are "man.funcprototype.font" and
"man.funcsynopsisinfo.font". To be documented
later.Closes #1452247. Thanks to Joe Orton for the feature
request.Modified: params/man.string.subst.map.xml,1.16;
manpages/block.xsl,1.10; manpages/docbook.xsl,1.51;
manpages/inline.xsl,1.16; manpages/synop.xsl,1.27 - Michael(tm)
Smithfop.extensions now only
for FOP version 0.20.5 and earlier.Modified: params/fop.extensions.xml,1.4
- Robert StaytonSupport for fop1 different from
fop 0.20.5 and earlier.Modified: params/fop1.extensions.xml,1.1 - Robert
StaytonReset default value to empty
string so template uses gentext first, then the parameter value
if not empty.Modified: params/index.number.separator.xml,1.2;
params/index.range.separator.xml,1.2;
params/index.term.separator.xml,1.2 - Robert
StaytonNew parameter:
id.warnings. If non-zero, warnings are
generated for titled objects that don't have titles. True by default;
I wonder if this will be too aggressive?Modified: html/biblio.xsl,1.25;
html/component.xsl,1.27; html/division.xsl,1.11; html/formal.xsl,1.19;
html/glossary.xsl,1.20; html/html.xsl,1.13; html/index.xsl,1.16;
html/param.ent,1.88; html/param.xweb,1.97; html/refentry.xsl,1.22;
html/sections.xsl,1.30; params/id.warnings.xml,1.1 - Norman
WalshAdded new parameter
keep.relative.image.urisModified: fo/param.ent,1.91;
fo/param.xweb,1.104; html/param.ent,1.87; html/param.xweb,1.96;
params/keep.relative.image.uris.xml,1.1 - Norman
WalshSupport default label
width parameters for itemized and ordered listsModified: fo/lists.xsl,1.64;
fo/param.ent,1.90; fo/param.xweb,1.103;
params/itemizedlist.label.width.xml,1.1;
params/orderedlist.label.width.xml,1.1 - Norman
WalshAdded parameters to localize
punctuation in indexes.Modified: params/index.number.separator.xml,1.1;
params/index.range.separator.xml,1.1;
params/index.term.separator.xml,1.1 - Robert
StaytonAdded two new parameters for
handling of multi-term
varlistentry elements:variablelist.term.break.after:
When the variablelist.term.break.after is
non-zero, it will generate a line break after each
term multi-term
varlistentry.variablelist.term.separator:
When a varlistentry contains multiple term
elements, the string specified in the value of the
variablelist.term.separator parameter is
placed after each term except the last. The default
is ", " (a comma followed by a space). To suppress rendering of
the separator, set the value of
variablelist.term.separator to the empty
string ("").These parameters are primarily intended to be
useful if you have multi-term varlistentries that have long
terms.Closes #1306676. Thanks to Sam Steingold for
providing an example "lots of long terms" doc that demonstrated
the value of having these options.Also, added
normalize-space() call to processing of each
term.This change affects all output formats
(HTML, PDF, manpages). The default behavior should pretty much
remain the same as before, but it is possible (as always) that
the change may introduce some
new bugginess.Modified: fo/lists.xsl,1.62; fo/param.ent,1.88;
fo/param.xweb,1.99; html/lists.xsl,1.48; html/param.ent,1.86;
html/param.xweb,1.93; manpages/lists.xsl,1.22;
manpages/param.ent,1.14; manpages/param.xweb,1.16;
params/variablelist.term.break.after.xml,1.1;
params/variablelist.term.separator.xml,1.1 - Michael(tm)
SmithConvert 'no' to string in default
value.Modified: params/olink.doctitle.xml,1.4 - Robert
StaytonImplemented RFE
#1292615.Added bunch of new parameters (attribute sets)
that affect list presentation: list.block.properties,
itemizedlist.properties, orderedlist.properties,
itemizedlist.label.properties and
orderedlist.label.properties. Default behaviour
of stylesheets has not been changed but further customizations will be
much more easier.Modified: fo/lists.xsl,1.61; fo/param.ent,1.87;
fo/param.xweb,1.98; params/itemizedlist.label.properties.xml,1.1;
params/itemizedlist.properties.xml,1.1;
params/list.block.properties.xml,1.1;
params/orderedlist.label.properties.xml,1.1;
params/orderedlist.properties.xml,1.1 - Jirka
KosekImplemented RFE
#1242092.You can enable crop marks in your document by
setting crop.marks=1 and xep.extensions=1. Appearance of crop
marks can be controlled by parameters
crop.mark.bleed (6pt),
crop.mark.offset (24pt) and
crop.mark.width (0.5pt).Also there
is new named template called user-xep-pis. You can overwrite it in
order to produce some PIs that can control XEP as described in
http://www.renderx.com/reference.html#Output_FormatsModified: fo/docbook.xsl,1.36;
fo/param.ent,1.86; fo/param.xweb,1.97; fo/xep.xsl,1.23;
params/crop.mark.bleed.xml,1.1; params/crop.mark.offset.xml,1.1;
params/crop.mark.width.xml,1.1; params/crop.marks.xml,1.1 - Jirka
KosekChanged short descriptions in doc
for *autolabel* params to match new autolabel
behavior.Modified: params/appendix.autolabel.xml,1.5;
params/chapter.autolabel.xml,1.4; params/part.autolabel.xml,1.5;
params/preface.autolabel.xml,1.4 - Michael(tm)
SmithProfilingThe following changes have been made to the
profiling code
since the 1.69.1 release.Profiling now works together with
namespace stripping (V5 documents). Namespace striping should work
with all stylesheets named profile-, even if they are not supporting
namespace stripping in a non-profiling
variant.Modified: profiling/profile-mode.xsl,1.4;
profiling/xsl2profile.xsl,1.7 - Jirka KosekMoved profiling stage out of
templates. This make possible to reuse profiled content by several
templates and still maintaing node indentity (needed for example for
HTML Help where content is processed multiple times).I
don't know why this was not on the top level before. Maybe some XSLT
processors choked on it. I hope this will be OK
now.Modified: profiling/xsl2profile.xsl,1.5 - Jirka
KosekToolsThe following changes have been made to the
tools code
since the 1.69.1 release.Moved Makefile.DocBook from
contrib module to xsl
module.Modified: tools/make/Makefile.DocBook,1.1 - Michael(tm)
SmithWordMLThe following changes have been made to the
wordml code
since the 1.69.1 release.added contrib element,
better handling of default paragraph
styleModified: wordml/pages-normalise.xsl,1.6; wordml/supported.xml,1.2;
wordml/wordml-final.xsl,1.14 - Steve Balladded
bridgeheadModified: wordml/docbook-pages.xsl,1.6;
wordml/docbook.xsl,1.17; wordml/pages-normalise.xsl,1.5;
wordml/template-pages.xml,1.7; wordml/template.dot,1.4;
wordml/template.xml,1.14; wordml/wordml-final.xsl,1.13 - Steve
Balladded blocks stylesheet to support
bibliographies, glossaries and qandasetsModified: wordml/Makefile,1.4;
wordml/README,1.3; wordml/blocks-spec.xml,1.1;
wordml/docbook-pages.xsl,1.5; wordml/docbook.xsl,1.16;
wordml/pages-normalise.xsl,1.4; wordml/sections-spec.xml,1.3;
wordml/specifications.xml,1.13; wordml/template-pages.xml,1.6;
wordml/template.dot,1.3; wordml/template.xml,1.13;
wordml/wordml-blocks.xsl,1.1; wordml/wordml-final.xsl,1.12;
wordml/wordml-sections.xsl,1.3 - Steve Balladded mediaobjectcaptionModified: wordml/docbook-pages.xsl,1.4;
wordml/docbook.xsl,1.15; wordml/specifications.xml,1.12;
wordml/template-pages.xml,1.5; wordml/template.dot,1.2;
wordml/template.xml,1.12; wordml/wordml-final.xsl,1.11 - Steve
Balladded
calloutsModified: wordml/docbook-pages.xsl,1.3; wordml/docbook.xsl,1.14;
wordml/pages-normalise.xsl,1.3; wordml/specifications.xml,1.11;
wordml/template-pages.xml,1.4; wordml/wordml-final.xsl,1.10 - Steve
Balladded Word template
fileModified: wordml/template.dot,1.1 - Steve Balladded abstract, fixed
itemizedlist, ulinkModified: wordml/specifications.xml,1.10;
wordml/wordml-final.xsl,1.9 - Steve Ballfixed Makefile added many
features to Pages support added revhistory, inlines,
highlights, abstractModified: wordml/Makefile,1.2;
wordml/docbook-pages.xsl,1.2; wordml/pages-normalise.xsl,1.2;
wordml/sections-spec.xml,1.2; wordml/specifications.xml,1.9;
wordml/template-pages.xml,1.3; wordml/template.xml,1.11;
wordml/wordml-final.xsl,1.8; wordml/wordml-sections.xsl,1.2 - Steve
Ballfixed handling linebreaks when
generating WordML added Apple Pages
supportModified: wordml/docbook.xsl,1.13; wordml/template-pages.xml,1.2 -
Steve BallRelease 1.69.1This release is a minor bug-fix update to the 1.69.0
release. Along with bug fixes, it includes one
configuration-parameter change: The default value of the
annotation.support parameter is now
0 (off). The reason for that change is that
there have been reports that annotation handling is
causing a significant performance degradation in processing of
large documents with xsltproc.Release 1.69.0The release includes major feature changes,
particularly in the manpages
stylesheets, as well as a large number of bug fixes.As with all DocBook Project dot zero releases, this is an
experimental release .CommonThis release adds localizations for the following
languages:
AlbanianAmharicAzerbaijaniHindiIrish (Gaelic)GujaratiKannadaMongolianOriyaPunjabiTagalogTamilWelsh.Added support for specifying number format for auto
labels for chapter, appendix,
part, and preface. Contolled with the
appendix.autolabel,
chapter.autolabel,
part.autolabel, and
preface.autolabel parameters.Added basic support for biblioref cross
referencing.Added support for align
on caption in mediaobject.Added support for processing documents that use the
DocBook V5 namespace.Added support for termdef and
mathphrase.EXPERIMENTAL: Incorporated the Slides and Website
stylesheets into the DocBook XSL stylesheets package. So,
for example, Website documents can now be processed using
the following URI for the driver Website
tabular.xsl file: http://docbook.sourceforge.net/release/xsl/current/website/tabular.xslA procedure without a title is
now treated as an informal procedure (meaning
that it is not added to any generated list of
procedures and has no affect on numbering of
generated labels for other procedures).docname is no longer added to
olink when pointing to a root element.Added support for generation of choice separator in
inline simplelist. This enables auto-generation of an
appropriate localized choice separator (for
example, and or or) before the
final item in an inline simplelist.To indicate that you want a choice separator
generated for a particular list, you need to put a processing
instruction (PI) of the form
dbchoice choice="foo" as a
child of the list. For example:
<para>Choose from
ONE and ONLY ONE of the following:
<simplelist type="inline">
<?dbchoice choice="or" ?>
<member>A</member>
<member>B</member>
<member>C</member>.</simplelist></para>
Output (for English):
Choose from ONE and only ONE of the
following choices: A, B, or C.
As a temporary workaround for the fact that most of the
DocBook non-English locale files don't have a localization for
the word or, you can put in a literal string to
be used; example for French: dbchoice choice="ou". That is, use
ou instead of or.FO Added content-type property to
external-graphic element, based on
imagedataformat
attribute.Added support for generating
<rx:meta-field creator="$VERSION"/>
field for XEP output. This makes the DocBook XSL
stylesheet version information available through the
Document Properties menu in Acrobat
Reader and other PDF viewers.Trademark symbol handling made consistent with
handling of same in HTML stylesheets. Prior to this change,
if you processed a document that contained no value for the
class attribute on the
trademark element, the HTML stylesheets would
default to rendering a superscript TM
symbol after the trademark contents,
but the FO stylesheets would render nothing.Added support for generating XEP bookmarks for
refentry.Added support for HTML markup tableborder attribute, applied to each
table cell.The table.width template can now
sum column specs if none use % or
*.Added fox:destination extension
inside fox:outline to support linking to
internal destinations.Added support for customizing
abstract with property sets. Controlled
with the abstract.properties and
abstract.title.properties
parameters.Add footnotes in table title to
table footnote set, and add support for table footnotes to
HTML table markup.Added support for title in
glosslist.Added support for itemizedlist symbol
none.Implemented the new
graphical.admonition.properties and
nongraphical.admonition.properties
attribute sets.Added id to
formalpara and some other blocks that were
missing it.Changed the anchor template to output
fo:inline instead of
fo:wrapper.Added support for toc.max.depth
parameter.HelpEclipse Help: Added support for generating olink
database.HTMLAdded a first cut at support in HTML output for
DocBook 5 style annotations. Controlled using the
annotation.support parameter, and
implemented using JavaScript and CSS styling. For more
details, see the documentation for the
annotation.js,
annotation.css,
annotation.graphic.open, and
annotation.graphic.close
parameters.Generate client-side image map for
imageobjectco with areas using
calspair unitsAdded support for img.src.path PI.Added support for passing
img.src.path to DocBook Java XSLT
image extensions when appropriate. Controlled using the
graphicsize.use.img.src.path
parameter.Added support for (not
valid for DocBook 4) xlink:href
on area and (not valid for DocBook 4)
alt in area.Added new parameter
default.table.frame to control table
framing if there is no frame
attribute on a table.Added initial, experimental support for generating
content for the HTML title attribute from
content of the alt element. This change adds
support for the following inline elements only (none of them
are block elements):
abbrevaccelacronymactionapplicationauthorinitialsbeginpagecitationciterefentrycitetitlecityclassnamecodecommandcomputeroutputconstantcountrydatabaseemailenvarerrorcodeerrornameerrortexterrortypeexceptionnamefaxfilenamefirstnamefirsttermforeignphrasefunctionglosstermguibuttonguiiconguilabelguimenuguimenuitemguisubmenuhardwarehonorificinterfaceinterfacenamekeycapkeycodekeysymlineagelineannotationliteralmarkupmedialabelmethodnamemousebuttonoptionoptionalotheraddrothernamepackageparameterpersonnamephonepobpostcodeproductnameproductnumberpromptpropertyquoterefentrytitleremarkreplaceablereturnvaluetagshortcutstatestreetstructfieldstructnamesubscriptsuperscriptsurnamesymbolsystemitemtagtermdeftokentrademarktypeuriuserinputvarnamewordaswordAdded support for chunking revhistory into
separate file (similar to the support for doing same with
legalnotice). Patch from Thomas
Schraitle. Controlled through new
generate.revhistory.link parameter.l10n.xsl: Made language codes RFC compliant. Added a
new boolean config parameter,
l10n.lang.value.rfc.compliant. If it
is non-zero (the default), any underscore in a language code
will be converted to a hyphen in HTML output. If it is zero,
the language code will be left as-is.manThis release closes out 44 manpages stylesheet bug reports
and feature requests. It adds more than 35 new configuration
parameters for controlling aspects of man-page output --
including hyphenation and justification, handling of links,
conversion of Unicode characters, and contents of man-page
headers and footers.New options for globally disabling/enabling
hyphenation and justification:
man.justify and
man.hyphenate.Note that the default
for the both of those is zero (off), because justified text
looks good only when it is also hyphenated; to quote the
Hyphenation node from the groff info page:
Since the odds are not great for finding a
set of words, for every output line, which fit nicely on a
line without inserting excessive amounts of space between
words, `gtroff' hyphenates words so that it can justify
lines without inserting too much space between
words.
The problem is that groff can end up hyphenating a lot of
things that you don't want hyphenated (variable names and
command names, for example). Keeping both justification and
hyphenation disabled ensures that hyphens won't get inserted
where you don't want to them, and you don't end up with
lines containing excessive amounts of space between
words. These default settings run counter to how most
existing man pages are formatted. But there are some notable
exceptions, such as the perl man pages. Added parameters for controlling hyphenation of
computer inlines, filenames, and URLs. By default, even when
hyphenation is enabled (globally), hyphenation is now
suppressed for "computer inlines" (currently, just
classname, constant, envar,
errorcode, option,
replaceable, userinput,
type, and varname, and for
filenames, and for URLs from link. It
can be (re)enabled using the
man.hyphenate.computer.inlines,
man.hyphenate.filenames, and
man.hyphenate.urls parameters.Implemented a new system for replacing Unicode
characters. There are two parts to the new system: a
string substitution map for doing
essential replacements, and a
character map that can optionally be disabled
and enabled.The new system fixes all open bugs that had to do with
literal Unicode numbered entities such as “ and
” showing up in output, and greatly expands the
ability of the stylesheets to generate good roff
equivalents for Unicode symbols and special
characters.Here are some details...The previous manpages mechanism for replacing Unicode
symbols and special characters with roff equivalents (the
replace-entities template) was not
scalable and not complete. The mechanism handled a somewhat
arbitrary selection of less than 20 or so Unicode
characters. But there are potentially more than
800 Unicode special characters that
have some groff equivalent they can be mapped to. And there
are about 34 symbols in the Latin-1 (ISO-8859-1) block
alone. Users might reasonably expect that if they include
any of those Latin-1 characters in their DocBook source
documents, they will get correctly converted to known roff
equivalents in output.In addition to those common symbols, certain users may
have a need to use symbols from other Unicode blocks. Say,
somebody who is documenting an application related to math
might need to use a bunch of symbols from the
Mathematical Operators Unicode block (there
are about 65 characters in that block that have reasonable
roff equivalents). Or somebody else might really like
Dingbats -- such as the checkmark character -- and so might
use a bunch of things from the Dingbat block
(141 characters in that that have roff equivalents or that
can at least be degraded somewhat gracefully
into roff).So, the old replace-entities
mechanism was replaced with a completely different mechanism
that is based on use of two maps: a
substitution map and a character
map (the latter in a format compliant with the XSLT
2.0 spec and therefore completely forward
compatible with XSLT 2.0).The substitution map is controlled through the
man.string.subst.map parameter, and
is used to replace things like the backslash character
(which needs special handling to prevent it from being
interpreted as a roff escape). The substitution map cannot
be disabled, because disabling it will cause the output to
be broken. However, you can add to it and change it if
needed.The character map mechanism, on the
other hand, can be completely disabled. It is enabled by
default, and, by default, does replacement of all Latin-1
symbols, along with most special spaces, dashes, and quotes
(about 75 characters by default). Also, you can optionally
enable a full character map that provides
support for converting all 800 or so of the characters that
have some reasonable groff equivalent.The character-map mechanism is controlled through the
following parameters:
man.charmap.enabledturns character-map support
on/offman.charmap.use.subsetspecifies that a subset of the character
map is used instead of the full mapman.charmap.subset.profilespecifies profile of character-map
subsetman.charmap.urispecifies an alternate character map to
use instead of the standard character map
provided in the distributionImplemented out-of-line handling of display of URLs
for links (currently, only for ulink). This gives
you three choices for handling of links:
Number and list links. Each link is numbered
inline, with a number in square brackets preceding the
link contents, and a numbered list of all links is added
to the end of the document.Only list links. Links are not numbered, but an
(unnumbered) list of links is added to the end of the
document.Suppress links. Don't number links and don't add
any list of links to the end of the document.
You can also choose whether links should be underlined. The
default is the works -- list, number, and
underline links. You can use the
man.links.list.enabled,
man.links.are.numbered, and
man.links.are.underlined parameters
to change the defaults. The default heading for the link
list is REFERENCES. You can be change that using the
man.links.list.heading
parameter.Changed default output encoding to UTF-8. This does not mean that man pages are output in
raw UTF-8, because the character map is applied
before final output, causing all UTF-8 characters covered in
the map to be converted to roff equivalents.Added support for processing refsect3 and
formalpara and nested refsection
elements, down to any arbitrary level of nesting.Output of the NAME and
SYNOPSIS and AUTHOR
headings and the headings for admonitions (note,
caution, etc.) are no longer hard-coded for
English. Instead, headings are generated for those in the
correct locale (just as the FO and HTML stylesheets
do).Re-worked mechanism for assembling page
headers/footers (the contents of the .TH
macro title line).Here are some details...All man pages contain a .TH roff
macro whose contents are used for rendering the title
line displayed in the header and footer of each
page. Here are a couple of examples of real-world man pages
that have useful page headers/footers:
gtk-options(7) GTK+ User's Manual gtk-options(7) <-- header
GTK+ 1.2 2003-10-20 gtk-options(7) <-- footer
svgalib(7) Svgalib User Manual svgalib(7) <-- header
Svgalib 1.4.1 16 December 1999 svgalib(7) <-- footerAnd here are the terms with which the
groff_man(7) man page refers to the
various parts of the header/footer:
title(section) extra3 title(section) <- header
extra2 extra1 title(section) <- footer Or, using the names with which the man(7)
man page refers to those same fields:
title(section) manual title(section) <- page header
source date title(section) <- page footerThe easiest way to control the contents of those
fields is to mark up your refentry content like
the following (note that this is a minimal
example).
<refentry>
<info>
<date>2003-10-20</date>
</info>
<refmeta>
<refentrytitle>gtk-options</refentrytitle>
<manvolnum>7</manvolnum>
<refmiscinfo class="source-name">GTK+</refmiscinfo>
<refmiscinfo class="version">1.2</refmiscinfo>
<refmiscinfo class="manual">GTK+ User's Manual</refmiscinfo>
</refmeta>
<refnamediv>
<refname>gtk-options</refname>
<refpurpose>Standard Command Line Options for GTK+ Programs</refpurpose>
</refnamediv>
<refsect1>
<title>Description</title>
<para>This manual page describes the command line options, which
are common to all GTK+ based applications.</para>
</refsect1>
</refentry>Sets the date part of the header/footer.Sets the title part.Sets the section part.Sets the source name part.Sets the version part.Sets the manual part.Below are explanations of the steps the stylesheets
take to attempt to assemble and display
good headers and footer. [In the
descriptions, note that *info
is the refentryinfo child
(whatever its name), and
parentinfo is the
info child of its parent (again, whatever
its name).]
extra1 field (date)Content of the extra1 field is
what shows up in the center
footer position of each page. The
man(7) man page describes it as
the date of the last revision.To provide this content, if the
refentry.date.profile.enabled
is non-zero, the stylesheets check the value of
refentry.date.profile.Otherwise, by default, they check for a
date or pubdate not only in the
*info contents, but also in
the parentinfo
contents.If a date cannot be found, the stylesheets now
automatically generate a localized long
format date, ensuring that this field always
has content in output.However, if for some reason you want to suppress
this field, you can do so by setting a non-zero value
for man.th.extra1.suppress.extra2 field (source)On Linux systems and on systems with a modern
groff, the content of the extra2 field
are what shows up in the left
footer position of each page.The man(7) man page describes
this as the source of the command, and
provides the following examples:
For binaries, use somwething like: GNU,
NET-2, SLS Distribution, MCC Distribution.For system calls, use the version of the
kernel that you are currently looking at: Linux
0.99.11.For library calls, use the source of the
function: GNU, BSD 4.3, Linux DLL 4.4.1.In practice, there are many pages that simply
have a version number in the source
field. So, it looks like what we have is a two-part
field,
NameVersion,
where:
Nameproduct name (e.g., BSD) or org. name
(e.g., GNU)Versionversion name
Each part is optional. If the
Name is a product name,
then the Version is
probably the version of the product. Or there may be
no Name, in which case, if
there is a Version, it is
probably the version of the item itself, not the
product it is part of. Or, if the
Name is an organization
name, then there probably will be no
Version.
To provide this content, if the
refentry.source.name.profile.enabled
and
refentry.version.profile.enabled
parameter are non-zero, the stylesheets check the
value of refentry.source.name.profilerefentry.version.profile.Otherwise, by default, they check the following
places, in the following order:
*info/productnumber*info/productnumberrefmeta/refmiscinfo[@class = 'version']parentinfo/productnumber*info/productnameparentinfo/productnamerefmeta/refmiscinfo[nothing found, so leave it empty]extra3 fieldOn Linux systems and on systems with a modern
groff, the content of the extra3 field
are what shows up in the center
header position of each page. Some man
pages have extra2 content, some
don't. If a particular man page has it, it is most
often context data about some larger
system the documented item belongs to (for example,
the name or description of a group of related
applications). The stylesheets now check the following
places, in the following order, to look for content to
add to the extra3 field.parentinfo/titleparent's titlerefmeta/refmiscinfo[nothing found, so leave it empty]Reworked *info gathering. For
each refentry found, the stylesheets now cache its
*info content, then check for any
valid parent of it that might have metainfo content and cache
that, if found; they then then do all further matches against
those node-sets (rather than re-selecting the original
*info nodes each time they are
needed).New option for breaking strings after forward
slashes. This enables long URLs and pathnames to be broken
across lines. Controlled through
man.break.after.slash parameter.Output for servicemark and trademark are now
(SM) and (TM). There is
a groff "\(tm" escape, but output from that
is not acceptable.New option for controlling the length of the title
part of the .TH title line. Controlled
through the man.th.title.max.length
parameter.New option for specifying output encoding of each man
page; controlled with
man.output.encoding (similar to the
HTML chunker.output.encoding
parameter).New option for suppressing filename messages when
generating output; controlled with
man.output.quietly (similar to the HTML
chunk.quietly parameter).The text of cross-references to first-level
refentry (refsect1, top-level
refsection, refnamediv, and
refsynopsisdiv) are now capitalized.Cross-references to refnamediv now use the
localized NAME title instead of using the
first refname child. This makes the output
inconsistent with HTML and FO output, but for man-page output,
it seems to make better sense to have the
NAME. (It may actually make better sense to
do it that way in HTML and FO output as well...)Added support for processing funcparams.Removed the space that was being output between
funcdef and paramdef; example: was:
float rand (void); now:
float rand(void)Turned off bold formatting for the type
element when it occurs within a funcdef or
paramdefCorrected rendering of simplelist. Any
<simplelist type="inline" instance
is now rendered as a comma-separated list (also with an
optional localized and or or before the last item -- see
description elsewhere in these release notes). Any simplelist
instance whose type is not
inline is rendered as a one-column vertical
list (ignoring the values of the type and columns attributes if present)Comment added at top of roff source for each page now
includes DocBook XSL stylesheets version number (as in the
HTML stylesheets)Made change to prevent sticky fonts
changes. Now, when the manpages stylesheets encounter node
sets that need to be boldfaced or italicized, they put the
\fBfoo\fR and \fIbar\fR
groff bold/italic instructions separately around each node in
the set.synop.xsl: Boldface everything in
funcsynopsis output except parameters (which are in
ital). The man(7) man page says:
For functions, the arguments are always specified
using italics, even in the SYNOPSIS section, where the rest
of the function is specified in bold.
A look through the contents of the
man/man2 directory shows that most
(all) existing pages do follow this everything in
funcsynopsis bold rule. That means the
type content and any punctuation (parens,
semicolons, varargs) also must be bolded.Removed code for adding backslashes before periods/dots
in roff source, because backslashes in front of periods/dots
in roff source are needed only in the very rare case where a
period is the very first character in a line, without any
space in front of it. A better way to deal with that rare case
is for you to add a zero-width space in front of the offending
dot(s) in your sourceRemoved special handling of the quote
element. That was hard-coded to cause anything marked up with
the quote element to be output preceded by two
backticks and followed by two apostrophes -- that is, that
old-school kludge for generating curly quotes in Emacs and
in X-Windows fonts. While Emacs still seems to support that, I
don't think X-Windows has for a long time now. And, anyway, it
looks (and has always looked) like crap when viewed on a
normal tty/console. In addition, it breaks localiztion of
quote. By default, quote content is
output with localized quotation marks, which, depending on the
locale, may or may not be left and right double quotation
marks.Changed mappings for left and right single quotation
marks. Those had previously been incorrectly mapped to the
backtick (`) and apostrophe (&39;) characters (for
kludgy reasons -- see above). They are now correctly mapped to
the \(oq and \(cq roff
escapes. If you want the old (broken) behavior, you need to
manually change the mappings for those in the value of the
man.string.subst.map parameter.Removed xref.xsl file. Now, of the
various cross-reference elements, only the ulink
element is handled differently; the rest are handled exactly
as the HTML stylesheets handle them, except that no hypertext
links are generated. (Because there is no equivalent hypertext
mechanism is man pages.)New option for making subheading dividers in generated
roff source. The dividers are not visible in the rendered man
page; they are just there to make the source
readable. Controlled using
man.subheading.divider.Fixed many places where too much space was being added
between lines.Release 1.68.1The release adds localization support for Farsi (thanks to
Sina Heshmati) and improved support for the XLink-based DocBook NG
db:link element. Other than that, it is a minor
bug-fix update to the 1.68.0 release. The main thing it fixes is a
build error that caused the XSLT Java extensions to be jarred up
with the wrong package structure. Thanks to Jens Stavnstrup for
quickly reporting the problem, and to Mauritz Jeanson for
investigating and finding the cause.Release 1.68.0This release includes some features changes, particularly
for FO/PDF output, and a number of bug fixes.
FOMoved footnote properties to attribute-sets.Added support for side floats, margin notes, and
custom floats.Added new parameters
body.start.indent and
body.end.indent to the
set.flow.properties template.Added support for xml:idAdded support for
refdescriptor.Added support for multiple refnamedivs.Added index.entry.properties
attribute-set to support customization of index
entries.Added set.flow.properties
template call to each fo:flow
to support customizations entry point.Add support for @floatstyle in
figureMoved hardcoded properties for index division titles
to the index.div.title.properties
attribute-set.Added support for
table-layout="auto" for XEP.Added index.div.title.properties
attribute-set.$verbose parameter is now
passed to most elements.Added refentry to
toc in part, as it is
permitted by the DocBook schema/DTD.Added backmatter elements and
article to toc in
part, since they are permitted by the
DocBook schema/DTD.Added mode="toc" for
simplesect, since it is now permitted in
the toc if
simplesect.in.toc is set.Moved hard-coded properties to
nongraphical.admonintion.properties
and graphical.admonition.properties
attribute sets.Added support for sidebar-width and
float-type processing instructions in
sidebar.For tables with HTML markup elements, added support
for dbfo bgcolor PI, the attribute-sets
named table.properties,
informaltable.properties,
table.table.properties, and
table.cell.padding. Also added
support for the templates named
table.cell.properties and
table.cell.block.properties so that
tabstyles can be implemented. Also added support for tables
containing only tr instead of
tbody with tr.Added new paramater
hyphenate.verbatim.characters which
can specify characters after which a line break can occur in
verbatim environments. This parameter can be used to extend
the initial set of characters which contain only space and
non-breakable space.Added itemizedlist.label.markup to enable
selection of different bullet symbol. Also added several
potential bullet characters, commented out by default.Enabled all id's in XEP output for external olinking.HTMLAdded support for
refdescriptor.Added support for multiple refnamedivs.Added support for xml:idrefsynopsisdiv as a section for
counting section levelsImagesAdded new SVG admonition graphics and navigation images.Release 1.67.2This release fixes a table bug introduced in the 1.67.1
release.Release 1.67.1This release includes a number of bug fixes.The following lists provide details about API and feature changes.
FOTables: Inherited cell properties are now passed to the
table.cell.properties template so they can
be overridden by a customization.Tables: Added support for bgcolor PI on table row
element.TOCs: Added new parameter
simplesect.in.toc; default value of
0 causes simplesect to be omitted from TOCs; to
cause simplesect to be included in TOCs, you
must set the value of simplesect.in.toc to
1.Comment from Norm:
Simplesect elements aren't supposed to
appear in the ToC at all... The use case for simplesect
is when, for example, every chapter in a book ends with
"Exercises" or "For More Information" sections and you
don't want those to appear in the ToC.
Sections: Reverted change that caused a variable reference
to be used in a template match and rewrote code to preserve
intended semantics.Lists: Added workaround to prevent "* 0.60 + 1em" garbage in
list output from PassiveTeXMoved the literal attributes from
component.title to the
component.title.properties attribute-set so
they can be customized.Lists: Added glossdef's first
para to special handling in
fo:list-item-body.HTMLTOCs: Added new parameter
simplesect.in.toc; for details, see
the list of changes for this
release.Indexing: Added new parameter
index.prefer.titleabbrev; when set to
1, index references will use
titleabbrev instead of
title when available.HTML HelpAdded support for generating windows-1252-encoded
output using Saxon; for more details, see the list of changes for this release.man pagesReplaced named/numeric character-entity references for
non-breaking space with groff equivalent (backslash-tilde).XSL Java extensionsSaxon extensions: Added the
Windows1252 class. It extends Saxon
6.5.x with the windows-1252 character set, which is
particularly useful when generating HTML Help for Western
European Languages (code from
PontusHaglund and contributed to the
DocBook community by Sectra AB, Sweden).To use:
Make sure that the Saxon 6.5.x jar file and the jar file for
the DocBook XSL Java extensions are in your CLASSPATHCreate a DocBook XSL customization layer -- a file named
mystylesheet.xsl or whatever -- that, at a
minimum, contains the following:
<xsl:stylesheet
xmlns:xsl="http://www.w3.org/1999/XSL/Transform"
version='1.0'>
<xsl:import href="http://docbook.sourceforge.net/release/xsl/current/htmlhelp/htmlhelp.xsl"/>
<xsl:output method="html" encoding="WINDOWS-1252" indent="no"/>
<xsl:param name="htmlhelp.encoding" select="'WINDOWS-1252'"></xsl:param>
<xsl:param name="chunker.output.encoding" select="'WINDOWS-1252'"></xsl:param>
<xsl:param name="saxon.character.representation" select="'native'"></xsl:param>
</xsl:stylesheet>Invoke Saxon with the
encoding.windows-1252 Java system property set
to com.nwalsh.saxon.Windows1252; for example
java \
-Dencoding.windows-1252=com.nwalsh.saxon.Windows1252 \
com.icl.saxon.StyleSheet \
mydoc.xml mystylesheet.xsl
Or, for a more complete "real world" case showing other
options you'll typically want to use:
java \
-Dencoding.windows-1252=com.nwalsh.saxon.Windows1252 \
-Djavax.xml.parsers.DocumentBuilderFactory=org.apache.xerces.jaxp.DocumentBuilderFactoryImpl \
-Djavax.xml.parsers.SAXParserFactory=org.apache.xerces.jaxp.SAXParserFactoryImpl \
-Djavax.xml.transform.TransformerFactory=com.icl.saxon.TransformerFactoryImpl \
com.icl.saxon.StyleSheet \
-x org.apache.xml.resolver.tools.ResolvingXMLReader \
-y org.apache.xml.resolver.tools.ResolvingXMLReader \
-r org.apache.xml.resolver.tools.CatalogResolver \
mydoc.xml mystylesheet.xsl
In both cases, the "mystylesheet.xsl" file should be a
DocBook customization layer containing the parameters
show in step 2.Saxon extensions: Removed Saxon 8 extensions from release packageRelease 1.67.0A number of important bug fixes.Added Saxon8 extensionsEnabled dbfo table-width on
entrytbl in FO outputAdded support for role=strong on
emphasis in FO outputAdded new FO parameter
hyphenate.verbatim that can be used to turn
on "intelligent" wrapping of verbatim environments.Replaced all <tt></tt> output with
<code></code>Changed admon.graphic.width template to a
mode so that different admonitions can have different graphical
widths.Deprecated the HTML shade.verbatim
parameter (use CSS instead)Wrapped ToC
refentrytitle/refname and
refpurpose in span with class values. This
makes it possible to style them using a CSS stylesheet.Use strong/em instead of
b/i in HTML outputAdded support for converting Emphasis to
groff italic and Emphasis role='bold' to
bold. Controlled by
emphasis.propagates.style param, but not
documented yet using litprog system. Will do that next (planning
to add some other parameter-controllable options for hyphenation
and handling of line spacing).callout.graphics.number.limit.xml
param: Changed the default from 10 to
15.verbatim.properties: Added
hyphenate=falseSaxon and Xalan Text.java extensions: Added support for
URIResolver() on insertfile href'sAdded generated RELEASE-NOTES.txt
file.Added INSTALL file (executable file for
generating catalog.xml)Removed obsolete tools directory from
packageRelease 1.66.1A number of important bug fixes.
Now xml:base attributes that are generated by an
XInclude processor are resolved for image files.
Rewrote olink templates to support several new features.
Extended full olink support to FO output.
Add support for xrefstyle attribute in olinks.
New parameters to support new olink features:
insert.olink.page.number, insert.olink.pdf.frag,
olink.debug, olink.lang.fallback.sequence, olink.properties,
prefer.internal.olink.
See the reference page for each parameter for more
information.
Added index.on.type parameter for new type
attribute introduced in DocBook 4.3 for indexterms and index.
This allows you to create multiple indices containing
different categories of entries.
For users of 4.2 and earlier, you can use the new parameter index.on.role
instead.
Added new
section.autolabel.max.depth parameter to turn off section numbering
below a certain depth.
This permits you to number major section levels and leave minor
section levels unnumbered.
Added footnote.sep.leader.properties attribute set to format
the line separating footnotes in printed output.
Added parameter img.src.path as a prefix to HTML img src
attributes.
The prefix is added to whatever path is already generated by the
stylesheet for each image file.
Added new attribute-sets
informalequation.properties,
informalexample.properties,
informalfigure.properties, and informaltable.properties,
so each such element type can be formatted
individually if needed.
Add component.label.includes.part.label
parameter to add any part number to chapter, appendix
and other component labels when
the label.from.part parameter is nonzero.
This permits you to distinguish multiple chapters with the same
chapter number in cross references and the TOC.
Added chunk.separate.lots parameter for HTML output.
This parameter lets you generate separate chunk files for each LOT
(list of tables, list of figures, etc.).Added several table features:
Added table.table.properties attribute set to add
properties to the fo:table element.
Added placeholder templates named table.cell.properties
and table.cell.block.properties to enable adding properties
to any fo:table-cell or the cell's fo:block, respectively.
These templates are a start for implementing table styles.
Added new attribute
set component.title.properties for easy modifications of
component's title formatting in FO output.
Added Saxon support for an encoding attribute on the textdata element. Added new parameter
textdata.default.encoding which specifies encoding when
encoding attribute on
textdata is missing.
Template label.this.section now controls whole
section label, not only sub-label which corresponds to
particular label. Former behaviour was IMHO bug as it was
not usable.
Formatting in titleabbrev for TOC and headers
is preserved when there are no hotlink elements in the title. Formerly the title showed only the text of the title, no font changes or other markup.
Added intial.page.number template to set the initial-page-number
property for page sequences in print output.
Customizing this template lets you change when page numbering restarts. This is similar to the format.page.number template that lets you change how the page number formatting changes in the output.
Added force.page.count template to set the force-page-count
property for page sequences in print output.
This is similar to the format.page.number template.
Sort language for localized index sorting in autoidx-ng.xsl is now taken from document
lang, not from system environment.
Numbering and formatting of normal
and ulink footnotes (if turned on) has been unified.
Now ulink footnotes are mixed in with any other footnotes.
Added support for renderas attribute in section and
sect1 et al.
This permits you to render a given section title as if it were a different level.
Added support for label attribute in footnote to manually
supply the footnote mark.
Added support for DocBook 4.3 corpcredit element.
Added support for a dbfo keep-together PI for
formal objects (table, figure, example, equation, programlisting). That permits a formal object to be kept together if it is not already, or to be broken if it
is very long and the
default keep-together is not appropriate.
For graphics files, made file extension matching case
insensitive, and updated the list of graphics extensions.
Allow calloutlist to have block content before
the first callout
Added dbfo-need processing instruction to provide
soft page breaks.
Added implementation of existing but unused
default.image.width parameter for graphics.
Support DocBook NG tag inline element.
It appears that XEP now supports Unicode characters in
bookmarks. There is no further need to strip accents from
characters.
Make segmentedlist HTML markup
more semantic and available to CSS styles.
Added user.preroot placeholder template to
permit xsl-stylesheet and other PIs and comments to be
output before the HTML root element.
Non-chunked legalnotice now gets an <a
name="id"> element in HTML output
so it can be referenced with xref or link.
In chunked HTML output, changed link rel="home" to rel="start",
and link rel="previous" to rel="prev", per W3C HTML 4.01
spec.
Added several patches to htmlhelp from W. Borgert
Added Bosnian locale file as common/bs.xml.
Release 1.65.0A number of important bug fixes.
Added a workaround to allow these stylesheets to process DocBook NG
documents. (It’s a hack that pre-processes the document to strip off the
namespace and then uses exsl:node-set to process
the result.)
Added alternative indexing mechanism which has better
internationalization support. New indexing method allows grouping of
accented letters like e, é, ë into the same group under letter "e". It
can also treat special letters (e.g. "ch") as one character and place
them in the correct position (e.g. between "h" and "i" in Czech
language).In order to use this mechanism you must create customization
layer which imports some base stylesheet (like
fo/docbook.xsl,
html/chunk.xsl) and then includes appropriate
stylesheet with new indexing code
(fo/autoidx-ng.xsl or
html/autoidx-ng.xsl). For example:<xsl:stylesheet xmlns:xsl="http://www.w3.org/1999/XSL/Transform"
version="1.0">
<xsl:import href="http://docbook.sourceforge.net/release/xsl/current/fo/docbook.xsl"/>
<xsl:include href="http://docbook.sourceforge.net/release/xsl/current/fo/autoidx-ng.xsl"/>
</xsl:stylesheet>New method is known to work with Saxon and it should also work
with xsltproc 1.1.1 and later. Currently supported languages are
English, Czech, German, French, Spanish and Danish.Release 1.64.1General bug fixes and improvements. Sorry about the failure to produce
an updated release notes file for 1.62.0—1.63.2In the course of fixing bug #849787, wrapping Unicode callouts
with an appropriate font change in the Xalan extensions, I discovered
that the Xalan APIs have changed a bit. So xalan2.jar
will work with older Xalan 2 implementations, xalan25.jar
works with Xalan 2.5.Release 1.61.0Lots of bug fixes and improvements.Initial support for timestamp PI. From now you
can use <?dbtimestamp format="Y-m-d H:M:S"?> to get current
datetime in your document. Added localization support for datetime PI
Added level 6 to test for section depth in
section.level template so that
section.title.level6.properties will be used for sections
that are 6 deep or deeper. This should also cause a h6 to be
created in html output.
Don't use SVG graphics if use.svg=0
Now uses number-and-title-template for sections
only if section.autolabel is not zero.
Added missing 'english-language-name' attribute to
the l10n element, and the missing 'style' attribute to the
template element so the current gentext documents will
validate.
Corrected several references to parameter
qanda.defaultlabel that were missing the "$".
Now accepts admon.textlabel parameter to turn off
Note, Warning, etc. label.
FeatReq #684561: support more XEP metadata
Added hyphenation support. Added support for coref.
Added beginpage support. (does nothing; see TDG).
Added support for
hyphenation-character, hyphenation-push-character-count, and
hyphenation-remain-character-count
Added root.properties,
ebnf.assignment,
and ebnf.statement.terminatorSupport bgcolor PI in table cells; make sure
rowsep and colsep don't have any effect on the last row or
column
Handle othercredit on titlepage a little
better
Applied fix from Jeff Beal that fixed the bug
that put secondary page numbers on primary entries. Same
with tertiary page numbers on secondary entries.
Added definition of missing variable
collection.
Make footnote formatting 'normal' even when it
occurs in a context that has special formatting
Added warning when glossary.collection is not
blank, but it cannot open the specified file.
Pick up the frame attribute on table and
informaltable.
indexdiv/title
in non-autogenerated indexes are
now picked up.
Removed (unused)
component.title.properties
Move IDs from
page-sequences down to titlepage blocks
Use
proportional-column-width(1) on more tables.
Use proportional-column-width() for
header/footer tables; suppress relative-align when when
using FOP
Check for glossterm.auto.link when linking
firstterms; don't output gl. prefix on glossterm links
Generate Part ToCs
Support glossary, bibliography,
and index in component ToCs.
Refactored chunking code so that
customization of chunk algorithm and chunk elements is more
practical
Support textobject/phrase
on inlinemediaobject.
Support 'start' PI on ordered lists
Fixed test of $toc PI to turn on qandaset TOC.
Added process.chunk.footnotes to sect2 through
5 to fix bug of missing footnotes when chunk level greater
than 1.
Added
paramater toc.max.depth which controls maximal depth of ToC
as requested by PHP-DOC group.
Exempted titleabbrev from preamble processing in
lists, and fixed variablelist preamble code to use the same
syntax as the other lists.
Added support for elements between variablelist
and first varlistentry since DocBook 4.2 supports that now.
Release 1.60.1Lots of bug fixes.The format of the titlepage.templates.xml files and
the stylesheet that transforms them have been significantly changed. All of the
attributes used to control the templates are now namespace qualified. So what
used to be:<t:titlepage element="article" wrapper="fo:block">is now:<t:titlepage t:element="article" t:wrapper="fo:block">Attributes from other namespaces (including those that are unqualified) are
now copied directly through. In practice, this means that the names that used
to be fo: qualified:<title named-template="component.title"
param:node="ancestor-or-self::article[1]"
fo:text-align="center"
fo:keep-with-next="always"
fo:font-size="&hsize5;"
fo:font-weight="bold"
fo:font-family="{$title.font.family}"/>are now unqualified:<title t:named-template="component.title"
param:node="ancestor-or-self::article[1]"
text-align="center"
keep-with-next="always"
font-size="&hsize5;"
font-weight="bold"
font-family="{$title.font.family}"/>The t:titlepage and t:titlepage-content
elements both generate wrappers now. And unqualified attributes on those elements
are passed through. This means that you can now make the title font apply to
ane entire titlepage and make the entire recto
titlepage centered by specifying the font and alignment on the those elements:<t:titlepage t:element="article" t:wrapper="fo:block"
font-family="{$title.font.family}">
<t:titlepage-content t:side="recto"
text-align="center">Support use of titleabbrev in running
headers and footers.
Added (experimental) xref.with.number.and.title
parameter to enable number/title cross references even when the
default would
be just the number.
Generate part ToCs if they're requested.
Use proportional-column-width() in header/footer tables.
Handle alignment correctly when screenshot
wraps a graphic in a figure.
Format chapter and appendix
cross references consistently.
Attempt to support tables with multiple tgroups
in FO.
Output fo:table-columns in
simplelist tables.
Use titlepage.templates.xml for
indexdiv and glossdiv formatting.
Improve support for new bibliography elements.
Added
footnote.number.format,
table.footnote.number.format,
footnote.number.symbols, and
table.footnote.number.symbols for better control of
footnote markers.
Added glossentry.show.acronyms.
Suppress the draft-mode page masters when
draft-mode is no.
Make blank pages verso not recto. D'Oh!
Improved formatting of ulink footnotes.
Fixed bugs in graphic width/height calculations.
Added class attributes to inline elements.
Don't add .html to the filenames identified
with the dbhtml PI.
Don't force a ToC when sections contain refentrys.
Make section title sizes a function of the
body.master.size.
Release 1.59.2The 1.59.2 fixes an FO bug in the page masters that causes FOP to fail.
Removed the region-name from the region-body of blank pages. There's
no reason to give the body of blank pages a unique name and doing so causes
a mismatch that FOP detects.
Output IDs for the first paragraphs in listitems.
Fixed some small bugs in the handling of page numbers in double-sided mode.
Attempt to prevent duplicated IDs from being produced when
endterm on xref points
to something with nested structure.
Fix aligment problems in equations.
Output the type attribute on unordered lists (UL) in HTML only if
the css.decoration parameter is true.
Calculate the font size in formal.title.properties so that it's 1.2 times
the base font size, not a fixed "12pt".
Release 1.59.1The 1.59.1 fixes a few bugs.
Added Bulgarian localization.
Indexing improvements; localize book indexes to books but allow setindex
to index an entire set.
The default value for rowsep and colsep is now "1" as per CALS.
Added support for titleabbrev (use them for cross
references).
Improvements to mediaobject for selecting print vs. online
images.
Added seperate property sets for figures,
examples, equations, tabless,
and procedures.
Make lineannotations italic.
Support xrefstyle attribute.
Make endterm on
xref higher priority than
xreflabel target.
Glossary formatting improvements.
Release 1.58.0The 1.58.0 adds some initial support for extensions in xsltproc, adds
a few features, and fixes bugs.
This release contains the first attempt at extension support for xsltproc.
The only extension available to date is the one that adjusts table column widths.
Run extensions/xsltproc/python/xslt.py.
Fixed bugs in calculation of adjusted column widths to correct for rounding
errors.
Support nested refsection elements correctly.
Reworked gentext.template to take context into consideration.
The name of elements in localization files is now an xpath-like context list, not
just a simple name.
Made some improvements to bibliography formatting.
Improved graphical formatting of admonitions.
Added support for entrytbl.
Support spanning index terms.
Support bibliosource.
Release 1.57.0The 1.57.0 release wasn't documented here. Oops.
Release 1.56.0The 1.56.0 release fixes bugs.
Reworked chunking. This will break all existing customizations
layers that change the chunking algorithm. If you're customizing chunking,
look at the new content parameter that's passed to
process-chunk-element and friends.
Support continued and inherited numeration in orderedlist
formatting for FOs.
Added Thai localization.
Tweaked stylesheet documentation stylesheets to link to TDG and
the parameter references.
Allow title on tables of contents ("Table of Contents") to be optional.
Added new keyword to generate.toc.
Support tables of contents on sections.
Made separate parameters for table borders and table cell borders:
table.frame.border.color,
table.frame.border.style,
table.frame.border.thickness,
table.cell.border.color,
table.cell.border.style, and
table.cell.border.thickness.
Suppress formatting of endofrangeindexterms.
This is only half-right. They should generate a range, but I haven't figured out how
to do that yet.
Support revdescription. (Bug #582192)
Added default.float.class and fixed figure
floats. (Bug #497603)
Fixed formatting of sbr in FOs.
Added context to the missing template error message.
Process arg correctly in a group.
(Bug #605150)
Removed 'keep-with-next' from formal.title.properties
attribute set now that the stylesheets support the option of putting
such titles below the object. Now the $placement value determines if
'keep-with-next' or 'keep-with-previous' is used in the title block.
Wrap url() around external-destinations when appropriate.
Fixed typo in compact list spacing. (Bug #615464)
Removed spurious hash in anchor name. (Bug #617717)
Address is now displayed verbatim on title pages. (Bug #618600)
The bridgehead.in.toc parameter is now properly
supported.
Improved effectiveness of HTML cleanup by increasing the number
of places where it is used. Improve use of HTML cleanup in XHTML stylesheets.
Support table of contents for appendix in
article. (Bug #596599)
Don't duplicate footnotes in bibliographys and
glossarys. (Bug #583282)
Added default.image.width. (Bug #516859)
Totally reworked funcsynopsis code; it now
supports a 'tabular' presentation style for 'wide' prototypes; see
funcsynopsis.tabular.threshold. (HTML only
right now, I think, FO support, uh, real soon now.)
Reworked support for difference marking; toned down the colors a bit
and added a system.head.content template so that the diff CSS
wasn't overriding user.head.content. (Bug #610660)
Added call to the *.head.content elements when writing
out long description chunks.
Make sure legalnotice link is correct even when
chunking to a different base.dir.
Use CSS to set viewport characteristics if
css.decoration is non-zero, use div instead of p for making
graphic a block element; make figure titles the
default alt
text for images in a figure.Added space-after to list.block.spacing.
Reworked section.level template to give correct answer
instead of being off by one.
When processing tables, use the tabstyle
attribute as the division class.
Fixed bug in html2xhtml.xsl that was causing the
XHTML chunker to output HTML instead of XHTML.
Older releasesTo view the release notes for older releases, see http://cvs.sourceforge.net/viewcvs.py/docbook/xsl/RELEASE-NOTES.xml. Be
aware that there were no release notes for releases prior to the
1.50.0 release.About dot-zero releasesDocBook Project “dot zero” releases should be
considered experimental and are always
followed by stable “dot one plus” releases, usually within
two or three weeks. Please help to ensure the stability of
“dot one plus” releases by carefully testing each
“dot zero” release and reporting back about any
problems you find. It is not recommended that you use a “dot zero”
release in a production system. Instead, you should wait for
the “dot one” or greater versions.